KEGG   Mus musculus (mouse): 18634
Entry
18634             CDS       T01002                                 

Gene name
Pex7, MmPEX7
Definition
(RefSeq) peroxisomal biogenesis factor 7
  KO
K13341  peroxin-7
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04146  Peroxisome
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04146 Peroxisome
    18634 (Pex7)
SSDB
Motif
Pfam: WD40 eIF2A
Other DBs
NCBI-GeneID: 18634
NCBI-ProteinID: NP_032848
MGI: 1321392
Ensembl: ENSMUSG00000020003
Vega: OTTMUSG00000031072
UniProt: P97865
Position
10; 10 A3
AA seq 318 aa
MSAARTLRVPGRHGYAAEFSPYLPGRLACAAAQHYGIAGCGTLLVLDQNESGLQIFRSFD
WNDGLFDVTWSENNEHVLVTCSGDGSLQLWDTAKATGPLQVYKEHTQEVYSVDWSQTRGE
QLVVSGSWDQTVKVWDPTVGNSLCTFRGHESVIYSTIWSPHIPGCFASASGDQTLRIWDV
KTTGVRIVIPAHQTEILSCDWCKYNENLVVTGAVDCSLRGWDLRNVRQPVFELLGHTYAI
RRVKFSPFHASVLASCSYDFTVRFWNFSKPDPLLETVEHHTEFTCGLDLSLQSPTQVADC
SWDETIKIYDPVCLTVPG
NT seq 957 nt   +upstreamnt  +downstreamnt
atgagcgcggcgcggacgctgcgggtgcccggccgccacggctatgcggccgagttctct
ccgtacctgccgggccgcctggcctgtgccgcggcgcagcactacggcatcgcgggctgt
ggaactctattagtattggatcaaaatgaatctggacttcagatttttagaagctttgac
tggaatgacggcttgtttgacgttacctggagtgaaaacaatgagcatgtccttgtcacc
tgtagtggtgatggctcactgcagctctgggacactgccaaagccacaggccctctccaa
gtctataaagagcacacgcaggaggtgtatagtgttgattggagccaaaccagaggtgaa
caacttgttgtgtctggctcatgggatcaaactgtcaaagtgtgggatccaactgttgga
aattctctgtgtacctttaggggccatgagagtgtcatttacagcacaatctggtctcct
cacatccctggttgtttcgcttcagcctcaggagatcagactctgaggatctgggatgtg
aagaccacaggagtacggattgtgattccagcacatcagacggaaatcctgagctgtgac
tggtgtaaatacaatgagaacttggtggtgacaggtgcggttgactgtagtttgagaggc
tgggacttaaggaatgtgcgacagcctgtgtttgaacttctcggtcacacatatgctatc
aggagggtgaaattttcaccgttccacgcctccgtgctggcctcctgctcctatgacttc
actgtaagattctggaatttttcaaagcctgatccgcttctggaaacagtggagcatcac
acagagtttacttgtggcttagacctgagtctccagagccccactcaggtagcagactgt
tcctgggatgaaaccataaagatctatgaccctgtttgtctcacggttcctggttaa

DBGET integrated database retrieval system