KEGG   Mus musculus (mouse): 18636
Entry
18636             CDS       T01002                                 

Gene name
Cfp, BCFG, Pf, Pfc
Definition
(RefSeq) complement factor properdin
  KO
K15412  complement factor properdin
Organism
mmu  Mus musculus (mouse)
Pathway
mmu05168  Herpes simplex virus 1 infection
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09160 Human Diseases
  09172 Infectious disease: viral
   05168 Herpes simplex virus 1 infection
    18636 (Cfp)
SSDB
Motif
Pfam: TSP_1 TSR TSP1_spondin TSP1_ADAMTS
Other DBs
NCBI-GeneID: 18636
NCBI-ProteinID: NP_032849
MGI: 97545
Ensembl: ENSMUSG00000001128
Vega: OTTMUSG00000017182
UniProt: P11680 A2AE15
Position
X A1.3; X 16.44 cM
AA seq 464 aa
MPAEMQAPQWLLLLLVILPATGSDPVLCFTQYEESSGRCKGLLGRDIRVEDCCLNAAYAF
QEHDGGLCQACRSPQWSAWSLWGPCSVTCSEGSQLRHRRCVGRGGQCSENVAPGTLEWQL
QACEDQPCCPEMGGWSEWGPWGPCSVTCSKGTQIRQRVCDNPAPKCGGHCPGEAQQSQAC
DTQKTCPTHGAWASWGPWSPCSGSCLGGAQEPKETRSRSCSAPAPSHQPPGKPCSGPAYE
HKACSGLPPCPVAGGWGPWSPLSPCSVTCGLGQTLEQRTCDHPAPRHGGPFCAGDATRNQ
MCNKAVPCPVNGEWEAWGKWSDCSRLRMSINCEGTPGQQSRSRSCGGRKFNGKPCAGKLQ
DIRHCYNIHNCIMKGSWSQWSTWSLCTPPCSPNATRVRQRLCTPLLPKYPPTVSMVEGQG
EKNVTFWGTPRPLCEALQGQKLVVEEKRSCLHVPVCKDPEEKKP
NT seq 1395 nt   +upstreamnt  +downstreamnt
atgcctgctgaaatgcaagcccctcagtggctcctgctgctactggttatcctgccagcc
acaggctcagaccctgtgctctgcttcacccagtatgaggagtcctctggcaggtgcaaa
ggcctacttgggagagacatcagggtagaagactgctgtctcaacgctgcctatgccttc
caggagcatgatggtggcctctgtcaggcatgcaggtctccacaatggtcagcatggtcc
ttatgggggccctgctcagttacatgttctgaggggtcccagctgcgacacaggcgctgt
gtgggcagaggtggtcagtgctctgagaatgtggctcctggaactcttgagtggcagcta
caggcctgtgaggaccagccatgctgtccagagatgggtggctggtctgagtggggaccc
tgggggccttgctctgtcacatgctccaaaggaacccagatccgtcaacgagtatgtgat
aatcctgctcctaagtgtgggggccactgcccaggagaggcccagcaatcacaggcctgt
gacacccagaagacctgccccacacatggggcctgggcatcctggggcccctggagcccc
tgctcaggatcctgccttggtggtgctcaagaacctaaggagacacgaagccgctcatgt
tctgcaccagcaccttcacaccagccccctgggaaaccctgctcaggaccagcctatgag
cataaggcctgcagtggcctaccaccttgcccagtggctggtggctgggggccatggagc
cctttgagcccctgctctgtgacttgtggcctgggccagaccctagagcaacggacatgt
gatcaccctgcaccccgtcatgggggccccttttgtgctggtgatgccactcggaaccaa
atgtgtaacaaagccgtaccttgccctgtaaacggggagtgggaggcctggggaaaatgg
agtgactgcagccggctgagaatgtccatcaactgtgaaggaaccccaggccagcagtca
cgttcaaggagctgtggcggccgcaaatttaatgggaagccatgtgctggaaaactccag
gatattcgacactgctataacatccataactgtatcatgaaaggttcatggtcacagtgg
agtacctggagtctgtgcacaccaccatgtagtcccaacgccacccgtgtccgccagcgc
ctctgcacacctttgctccccaagtacccgcctacagtttcaatggttgaaggtcagggt
gagaagaatgttaccttctgggggactccacggccactgtgtgaagcgctacaggggcag
aagctggtggtggaagagaaacggtcatgtctacatgtgcctgtctgcaaagacccagaa
gagaagaaaccctaa

DBGET integrated database retrieval system