KEGG   Mus musculus (mouse): 18639
Entry
18639             CDS       T01002                                 

Gene name
Pfkfb1, PFK/FBPase_1
Definition
(RefSeq) 6-phosphofructo-2-kinase/fructose-2,6-biphosphatase 1
  KO
K19028  6-phosphofructo-2-kinase / fructose-2,6-biphosphatase 1 [EC:2.7.1.105 3.1.3.46]
Organism
mmu  Mus musculus (mouse)
Pathway
mmu00051  Fructose and mannose metabolism
mmu01100  Metabolic pathways
mmu04152  AMPK signaling pathway
mmu04922  Glucagon signaling pathway
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00051 Fructose and mannose metabolism
    18639 (Pfkfb1)
 09130 Environmental Information Processing
  09132 Signal transduction
   04152 AMPK signaling pathway
    18639 (Pfkfb1)
 09150 Organismal Systems
  09152 Endocrine system
   04922 Glucagon signaling pathway
    18639 (Pfkfb1)
Enzymes [BR:mmu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.105  6-phosphofructo-2-kinase
     18639 (Pfkfb1)
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.46  fructose-2,6-bisphosphate 2-phosphatase
     18639 (Pfkfb1)
SSDB
Motif
Pfam: 6PF2K His_Phos_1 AAA_33 Zeta_toxin KTI12
Other DBs
NCBI-GeneID: 18639
NCBI-ProteinID: NP_032850
MGI: 107816
Ensembl: ENSMUSG00000025271
Vega: OTTMUSG00000019170
UniProt: P70266 A2AFM9
Position
X; X F3
AA seq 448 aa
MEEKASKRAASIPQFTNSPTMVIMVGLPARGKTYISTKLTRYLNWIGTPTKVFNLGQYRR
EAVSYRNYEFFRPDNMEAQLIRKQCALAALKDVHKYLSREEGHVAVFDATNTTRERRSLI
LQFAKEHGYKVFFIESICNDPDIIAENIKQVKLGSPDYIDCDQEKVLEDFLKRIECYEIN
YQPLDEELDSHLSYIKIFDVGTRYMVNRVQDHVQSRTAYYLMNIHVTPRSIYLCRHGESE
LNLRGRIGGDSGLSARGKQYAYALANFIRSQSISSLKVWTSHMKRTIQTAEALGVPYEQW
KALNEIDAGVCEEMTYEEIQEHYPEEFALRDQDKYRYRYPKGESYEDLVQRLEPVIMELE
RQENVLVICHQAVMRCLLAYFLDKSSDELPYLKCPLHTVLKLTPVAYGCRVESIYLNVEA
VNTHRDKPENVDITREPEEALDTVPAHY
NT seq 1347 nt   +upstreamnt  +downstreamnt
atggaagaaaaagcctctaagagagcagcctccataccacagttcactaattcccccaca
atggtgatcatggtgggtttaccagctcgaggcaagacctacatctctacgaagctcaca
cgctatctcaactggataggaacaccgactaaagtgtttaatttaggtcagtatcgacga
gaggcagtgagctacaggaactatgaattctttcgcccagacaacatggaggcccaactt
atcaggaagcagtgtgctctagcagccctaaaggatgtccataagtatctcagccgtgag
gaaggtcacgttgcggtttttgatgccaccaacactaccagagaacgacgatcattgatt
ctgcagtttgctaaagaacatggttacaaggtcttctttattgagtctatttgtaatgac
ccagacatcattgcagaaaacatcaagcaagtgaaactcggcagtcctgattacatagac
tgtgaccaagaaaaggttttagaagactttctaaagagaattgagtgctatgagatcaac
taccagcctttggatgaggaattggacagccacctgtcctacatcaagatcttcgatgtg
ggcacacgctacatggtaaatcgagtgcaagaccacgttcaaagccgtacagcctactac
ctcatgaacatccatgtcacacctcgatctatctacctatgccgacatggtgagagtgaa
ctcaaccttagaggccgcattggaggtgactctggcctctcagctcggggcaagcagtat
gcctatgccctggccaacttcattcggtctcaaagcatcagctccctgaaggtgtggact
agccacatgaagaggaccattcagacagctgaagccctaggcgtcccctatgaacagtgg
aaggccctgaatgagattgatgcgggtgtctgtgaagagatgacttatgaagaaattcag
gaacactaccctgaagaatttgcactacgggaccaggataaatatcgttaccgctatccc
aagggagagtcctatgaggatctggttcagcgtcttgagccagttataatggagctagaa
cggcaagaaaatgtactggtgatctgtcaccaggctgtcatgcggtgccttctagcatac
ttcctggataaaagttcagatgagctgccctatctcaagtgtcctctgcatacagtgctc
aaactcacacctgtggcttatggctgcagagtggagtccatctacctgaatgtggaggct
gtgaacacacaccgggacaagcctgagaatgtggacatcacccgtgaacccgaggaagcc
ctggacactgtccctgcccattactga

DBGET integrated database retrieval system