KEGG   Mus musculus (mouse): 18646Help
Entry
18646             CDS       T01002                                 

Gene name
Prf1, Pfn, Pfp, Prf-1
Definition
(RefSeq) perforin 1 (pore forming protein)
  KO
K07818  perforin 1
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04210  Apoptosis
mmu04650  Natural killer cell mediated cytotoxicity
mmu04940  Type I diabetes mellitus
mmu05320  Autoimmune thyroid disease
mmu05330  Allograft rejection
mmu05332  Graft-versus-host disease
mmu05416  Viral myocarditis
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    18646 (Prf1)
 09150 Organismal Systems
  09151 Immune system
   04650 Natural killer cell mediated cytotoxicity
    18646 (Prf1)
 09160 Human Diseases
  09163 Immune disease
   05320 Autoimmune thyroid disease
    18646 (Prf1)
   05330 Allograft rejection
    18646 (Prf1)
   05332 Graft-versus-host disease
    18646 (Prf1)
  09166 Cardiovascular disease
   05416 Viral myocarditis
    18646 (Prf1)
  09167 Endocrine and metabolic disease
   04940 Type I diabetes mellitus
    18646 (Prf1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: MACPF C2
Motif
Other DBs
NCBI-GeneID: 18646
NCBI-ProteinID: NP_035203
MGI: 97551
Ensembl: ENSMUSG00000037202
UniProt: P10820 A2RSY7
Structure
PDB: 

Position
10 B4; 10 32.18 cM
AA seq 554 aa AA seqDB search
MATCLFLLGLFLLLPRPVPAPCYTATRSECKQKHKFVPGVWMAGEGMDVTTLRRSGSFPV
NTQRFLRPDRTCTLCKNSLMRDATQRLPVAITHWRPHSSHCQRNVAAAKVHSTEGVAREA
AANINNDWRVGLDVNPRPEANMRASVAGSHSKVANFAAEKTYQDQYNFNSDTVECRMYSF
RLVQKPPLHLDFKKALRALPRNFNSSTEHAYHRLISSYGTHFITAVDLGGRISVLTALRT
CQLTLNGLTADEVGDCLNVEAQVSIGAQASVSSEYKACEEKKKQHKMATSFHQTYRERHV
EVLGGPLDSTHDLLFGNQATPEQFSTWTASLPSNPGLVDYSLEPLHTLLEEQNPKREALR
QAISHYIMSRARWQNCSRPCRSGQHKSSHDSCQCECQDSKVTNQDCCPRQRGLAHLVVSN
FRAEHLWGDYTTATDAYLKVFFGGQEFRTGVVWNNNNPRWTDKMDFENVLLSTGGPLRVQ
VWDADYGWDDDLLGSCDRSPHSGFHEVTCELNHGRVKFSYHAKCLPHLTGGTCLEYAPQG
LLGDPPGNRSGAVW
NT seq 1665 nt NT seq  +upstreamnt  +downstreamnt
atggccacgtgcctgttcctcctgggccttttcctgctgctgccacgacctgtccctgct
ccctgctacactgccactcggtcagaatgcaagcagaagcacaagttcgtgccaggtgta
tggatggctggggaaggcatggatgtgactaccctccgccgctccggctccttcccagtg
aacacacagaggttcctgaggcctgaccgcacctgcaccctctgtaaaaactccctaatg
agagacgccacacagcgcctacctgtggcaatcacccactggcggcctcacagctcacac
tgccagcgtaatgtggccgcagccaaggtccactccacggagggtgtggcccgggaggca
gctgctaatatcaataacgactggcgtgtggggctggatgtgaaccctaggccagaggca
aacatgcgcgcctccgtggctggctcccactccaaggtagccaattttgcagctgagaag
acctatcaggaccagtacaactttaatagcgacacagtagagtgtcgcatgtacagtttt
cgcctggtacaaaaacctccactccaccttgacttcaaaaaggcgctcagagccctcccc
cgcaactttaacagctccacagagcatgcttaccacaggctcatctcctcctatggcacg
cactttatcacggctgtggacctcggtggccgcatctcggtccttacagccctgcgtacc
tgtcagctgaccctgaatgggctcacagctgatgaggtaggagactgcctgaacgtggag
gcccaggtcagcatcggtgcccaagccagcgtctccagtgaatacaaagcttgtgaggag
aagaagaaacagcacaaaatggccacctctttccaccagacctaccgtgagcgtcacgtc
gaagtacttggtggccctctggactccacgcatgatctgctcttcgggaaccaagctaca
ccagagcagttctcaacctggacagcctcactgcccagcaaccctggtctggtggactac
agcctggagcccctgcacacattactggaagaacagaacccgaagcgggaggctctgaga
caggctatcagccattatataatgagcagagcccggtggcagaactgtagcaggccctgc
aggtcaggccagcataagagtagccatgattcatgccagtgtgagtgccaggattcaaag
gtcaccaaccaggactgctgcccacgacagaggggcttggcccatttggtggtaagcaat
ttccgggcagaacatctgtggggagactacaccacagctactgatgcctacctaaaggtc
ttctttggtggccaggagttcaggaccggtgtcgtgtggaacaataacaatccccggtgg
actgacaagatggactttgagaatgtgctcctgtccacagggggacccctcagggtgcag
gtctgggatgccgactacggctgggatgatgaccttcttggttcttgtgacaggtctccc
cactctggtttccatgaggtgacatgtgagctaaaccacggcagggtgaaattctcctac
catgccaagtgtctgccccatctcactggagggacctgcctggagtatgccccccagggg
cttctgggagatcctccaggaaaccgcagtggggctgtgtggtaa

DBGET integrated database retrieval system