KEGG   Mus musculus (mouse): 18667Help
Entry
18667             CDS       T01002                                 

Gene name
Pgr, 9930019P03Rik, BB114106, NR3C3, PR, PR-A, PR-B
Definition
(RefSeq) progesterone receptor
  KO
K08556  progesterone receptor
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04114  Oocyte meiosis
mmu04914  Progesterone-mediated oocyte maturation
mmu04915  Estrogen signaling pathway
mmu05224  Breast cancer
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04114 Oocyte meiosis
    18667 (Pgr)
 09150 Organismal Systems
  09152 Endocrine system
   04915 Estrogen signaling pathway
    18667 (Pgr)
   04914 Progesterone-mediated oocyte maturation
    18667 (Pgr)
 09160 Human Diseases
  09162 Cancer: specific types
   05224 Breast cancer
    18667 (Pgr)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:mmu03000]
    18667 (Pgr)
  09183 Protein families: signaling and cellular processes
   03310 Nuclear receptors [BR:mmu03310]
    18667 (Pgr)
Transcription factors [BR:mmu03000]
 Eukaryotic Type
  Zinc finger
   Cys4 estrogen-like
    18667 (Pgr)
Nuclear receptors [BR:mmu03310]
 3. Estrogen like
  3C. 3-Ketosteroid receptor
   18667 (Pgr)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Prog_receptor Hormone_recep zf-C4
Motif
Other DBs
NCBI-GeneID: 18667
NCBI-ProteinID: NP_032855
MGI: 97567
Ensembl: ENSMUSG00000031870
Vega: OTTMUSG00000022998
UniProt: Q00175 Q8BW69
Position
9; 9 A1
AA seq 926 aa AA seqDB search
MTELQAKDPQVLHTSGASPSPPHIGSPLLARLDSGPFQGSQHSDVSSVVSPIPISLDGLL
FPRSCRGPELPDGKTGDQQSLSDVEGAFSGVEATHREGGRNSRAPEKDSRLLDSVLDSLL
TPSGTEQSHASPPACEAITSWCLFGPELPEDPRSVPATKGLLSPLMSRPEIKAGDSSGTG
AGQKVLPKGLSPPRQLLLPTSGSAHWPGAGVKPSPQPAAGEVEEDSGLETEGSAAPLLKS
KPRALEGTGSGGGVAANAASAAPGGVTLVPKEDSRFSAPRVSLEQDSPIAPGRSPLATTV
VDFIHVPILPLNHALLAARTRQLLEGDSYDGGATAQGPFAPPRGSPSAPSPPVPCGDFPD
CTYPLEGDPKEDVFPLYGDFQTPGLKIKEEEEGADAAVRSPRPYLSAGASSSTFPDFPLA
PAPQRAPSSRPGEAAVAGGPSSAAVSPASSSGSALECILYKAEGAPPTQGSFAPLPCKPP
AAGSCLLPRDSLPAAPATAAAPAIYQPLGLNGLPQLGYQAAVLKDSLPQVYPPYLNYLRP
DSEASQSPQYGFDSLPQKICLICGDEASGCHYGVLTCGSCKVFFKRAMEGQHNYLCAGRN
DCIVDKIRRKNCPACRLRKCCQAGMVLGGRKFKKFNKVRVMRTLDGVALPQSVGLPNESQ
ALGQRITFSPNQEIQLVPPLINLLMSIEPDVVYAGHDNTKPDTSSSLLTSLNQLGERQLL
SVVKWSKSLPGFRNLHIDDQITLIQYSWMSLMVFGLGWRSYKHVSGQMLYFAPDLILNEQ
RMKELSFYSLCLTMWQIPQEFVKLQVTHEEFLCMKVLLLLNTIPLEGLRSQSQFEEMRSS
YIRELIKAIGLRQKGVVPSSQRFYQLTKLLDSLHDLVKQLHLYCLNTFIQSRTLAVEFPE
MMSEVIAAQLPKILAGMVKPLLFHKK
NT seq 2781 nt NT seq  +upstreamnt  +downstreamnt
atgactgagctgcaggcaaaggatccgcaggttctccacacgtctggcgcttcgccctcc
cccccacacatcgggtcccccttgcttgcacgcttggactcaggtcccttccaagggagc
cagcactcggacgtgtcgtctgtagtctcgcctataccgatctccctggacgggctgctt
tttcctcggtcctgccggggtcccgagctcccagacggaaagacaggggaccagcagtcg
ctgtccgacgtggagggagctttctctggggtagaagccactcatagggaaggaggcaga
aattccagagccccggagaaggacagcagactcttagacagtgtcttagactcgttgttg
actccctccgggaccgaacagagtcacgccagccctccagcctgcgaggccatcacttcc
tggtgtctctttgggccagagcttccagaagacccccgcagtgtccctgctaccaaaggg
ttgttgtccccgctcatgagtcggccagagatcaaggctggcgacagctccgggacagga
gcaggacagaaggtgctgcccaaaggactgtcaccacccaggcagctgttgctccctacc
tcggggagtgctcactggcccggggcaggggtgaagccgtccccgcagccagctgcaggg
gaggtggaagaggacagtggcctggagaccgagggctctgcagctccgcttctaaagagc
aaacctcgagcactggaaggcaccggcagcggaggaggagtcgcagccaacgcggcctca
gcggccccaggcggtgtcactctggtcccaaaggaagattcacggttttctgctcctagg
gtctccttggagcaagactctcccattgcccccgggcgctccccactggccaccacagtg
gtggatttcatccatgtgcccatcctgcctctgaaccacgcactcctggccgcccgcacc
cggcagctgctggagggggacagctacgacggcggggccacagcccagggcccttttgcc
ccgcctaggggctcgccctccgcgccatccccgccggtgccctgcggtgacttcccagac
tgcacctaccctctggaaggcgaccccaaagaggacgtgttccctctttacggcgacttc
cagacgcctggcttgaagatcaaggaggaggaggagggcgcggatgctgctgtgcgctcg
ccgcgcccctacctgtcggctggagccagctcctccaccttcccagacttcccgctggca
cccgcgccgcagcgagcgccatcctccaggcccggagaagcggcggtggccggcggaccc
agcagcgccgcggtgtcgccagcgtcctcctccggctccgcgctggagtgcatcctgtac
aaagcggagggcgcgccgcccacgcagggttcgttcgcgccactgccgtgcaagccccca
gccgccggctcctgcctactaccccgggacagcctgccggccgccccggccaccgccgca
gcacccgccatctaccagccgctcggcctcaatgggctcccgcagctgggctaccaggcc
gcggtgctcaaggacagcctgccccaggtctacccgccataccttaactacctgaggcca
gattcagaagccagccagagcccacagtatggctttgattccttacctcagaagatctgc
ttaatctgcggggatgaagcatctggctgtcactatggcgtgcttacctgtgggagctgc
aaggtcttctttaagagggcaatggaagggcagcataactatttatgtgctggaagaaat
gactgcattgttgataaaattcgcagaaaaaactgcccagcatgtcgtctgagaaagtgt
tgtcaggctggcatggtccttggaggtcgtaagtttaagaagtttaataaagtccgagtt
atgagaacccttgacggtgttgctctcccccagtcggtgggccttcctaacgagagccag
gccctgggccagagaatcaccttttcaccaaatcaagaaattcaactggtcccgccactc
atcaacctgctcatgagcattgagcctgatgtggtctatgcagggcatgacaacacaaag
cctgacacttccagctctttgctgaccagtctcaaccaactaggcgagagacaactgctt
tcagtagtcaaatggtctaaatctctgccaggtttccggaacttacacattgatgaccag
ataaccctgattcagtactcctggatgagcctgatggtgtttggcctggggtggaggtcg
tacaagcatgtcagtggacagatgctatattttgcacctgatctaatcctaaatgagcag
aggatgaaggagctgtcattctactcgctgtgccttaccatgtggcaaatcccacaggag
tttgtcaaactccaggtgacccatgaggaattcctctgtatgaaagtcttactacttctt
aacacaattcctttggaaggactgaggagtcaaagccagtttgaagagatgagatcaagc
tatatccgcgaattgatcaaggcaattggtttaagacagaaaggggttgtccccagctca
cagcgcttctaccaactcacaaaacttctcgacagcttgcatgatcttgtgaaacagctc
cacctgtactgcttgaatacattcatccaatcccggacactggctgtggaatttccggaa
atgatgtctgaagttattgctgcccagttgcccaagatcctggcgggcatggtgaagccg
ctcctctttcacaaaaagtga

DBGET integrated database retrieval system