KEGG   Mus musculus (mouse): 18674
Entry
18674             CDS       T01002                                 

Gene name
Slc25a3, 5730556H19Rik, PTP, Ph, Phc
Definition
(RefSeq) solute carrier family 25 (mitochondrial carrier, phosphate carrier), member 3
  KO
K15102  solute carrier family 25 (mitochondrial phosphate transporter), member 3
Organism
mmu  Mus musculus (mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:mmu02000]
    18674 (Slc25a3)
   04147 Exosome [BR:mmu04147]
    18674 (Slc25a3)
Transporters [BR:mmu02000]
 Solute carrier family (SLC)
  SLC25: Mitochondrial carrier
   18674 (Slc25a3)
Exosome [BR:mmu04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   18674 (Slc25a3)
SSDB
Motif
Pfam: Mito_carr
Other DBs
NCBI-GeneID: 18674
NCBI-ProteinID: NP_598429
MGI: 1353498
Ensembl: ENSMUSG00000061904
Vega: OTTMUSG00000035180
UniProt: Q8VEM8
Position
10; 10 C2
AA seq 357 aa
MFSSVAHLARANPFNAPHLQLVHDGLSGPRSPPAPPRRSRHLAAAAVEEYSCEFGSMKYY
ALCGFGGVLSCGLTHTAVVPLDLVKCRMQVDPQKYKGIFNGFSITLKEDGVRGLAKGWAP
TLIGYSMQGLCKFGFYEVFKALYSNILGEENTYLWRTSLYLASSASAEFFADIALAPMEA
AKVRIQTQPGYANTLREAVPKMYKEEGLNAFYKGVAPLWMRQIPYTMMKFACFERTVEAL
YKFVVPKPRSECTKAEQLVVTFVAGYIAGVFCAIVSHPADSVVSVLNKEKGSTASQVLQR
LGFRGVWKGLFARIIMIGTLTALQWFIYDSVKVYFRLPRPPPPEMPESLKKKLGLTE
NT seq 1074 nt   +upstreamnt  +downstreamnt
atgttctcgtccgtagcgcacctggcgcgggcgaaccccttcaacgcgccacacctgcag
ctggtgcacgatggcctgtcgggtccccgcagtcccccagctccgccccggcgttcccgc
cacctggccgccgccgccgtggaagagtacagttgtgaatttggctccatgaagtattat
gcactgtgtggctttggtggggtcttaagttgtgggctgacacacactgctgttgttccc
ctggacttagtaaagtgccgcatgcaggtggaccctcagaagtacaaaggcatatttaat
ggattctccattacactgaaagaagatggcgttcgtggtttggctaaaggatgggcccca
actttgattggctattccatgcaagggctctgcaaattcggcttttatgaagtcttcaaa
gccttatatagcaacatacttggtgaggaaaacacctacctgtggcgcacatcactgtat
ttagcttcttctgccagtgctgaattcttcgctgacattgccctggctcctatggaagct
gctaaagttcgaattcaaacccagcctggttatgccaacaccttgagggaagctgttccc
aaaatgtataaagaggaaggcttaaatgcgttctacaagggcgttgctcctctgtggatg
agacagatcccgtacaccatgatgaagttcgcctgctttgaacgtactgttgaagctttg
tacaaatttgtggttcctaagccccgaagtgaatgtacaaaggcagagcagctggttgtg
acatttgtggcaggttacatagctggagtcttctgtgcgatcgtctcccaccctgctgac
tctgtggtctctgtgctgaataaagagaaaggcagcaccgcgtctcaggtcctgcagagg
ctgggcttcagaggtgtgtggaaggggctcttcgcccgaatcatcatgattggcactctg
actgcactacagtggttcatctacgactctgtgaaggtctacttcaggctccctcgccct
cctccccctgagatgccagagtctctgaagaagaagcttgggttaactgagtag

DBGET integrated database retrieval system