KEGG   Mus musculus (mouse): 18700Help
Entry
18700             CDS       T01002                                 

Gene name
Piga, AI194334, Pig-a
Definition
(RefSeq) phosphatidylinositol glycan anchor biosynthesis, class A
  KO
K03857  phosphatidylinositol N-acetylglucosaminyltransferase subunit A [EC:2.4.1.198]
Organism
mmu  Mus musculus (mouse)
Pathway
mmu00563  Glycosylphosphatidylinositol (GPI)-anchor biosynthesis
mmu01100  Metabolic pathways
Module
mmu_M00065  GPI-anchor biosynthesis, core oligosaccharide
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00563 Glycosylphosphatidylinositol (GPI)-anchor biosynthesis
    18700 (Piga)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01003 Glycosyltransferases [BR:mmu01003]
    18700 (Piga)
Enzymes [BR:mmu01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.198  phosphatidylinositol N-acetylglucosaminyltransferase
     18700 (Piga)
Glycosyltransferases [BR:mmu01003]
 GPI-anchor biosynthesis
  Core oligosaccharide
   18700 (Piga)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PIGA Glyco_transf_4 Glycos_transf_1 Glyco_trans_1_4 Glyco_trans_4_4 Glyco_transf_5 Glyco_trans_1_2 DUF1538
Motif
Other DBs
NCBI-GeneID: 18700
NCBI-ProteinID: NP_035211
MGI: 99461
Ensembl: ENSMUSG00000031381
Vega: OTTMUSG00000019508
UniProt: Q64323 A2AIH5
Position
X F5; X 76.49 cM
AA seq 485 aa AA seqDB search
MANRRGGGQGQPPSVSPSPGSSGNLSDDRTCTHNICMVSDFFYPNMGGVESHIYQLSQCL
IERGHKVITVTHAYGNRKGVRYLTNGLKVYYLPLRVMYNQSTATTLFHSLPLLRYIFVRE
RITIIHSHSSFSAMAHDALFHAKTMGLQTVFTDHSLFGFADVSSVLTNKLLTVSLCDTNH
IICVSYTSKENTVLRAALNPEIVSVIPNAVDPTDFTPDPFRRHDSVITVVVVSRLVYRKG
TDLLSGIIPELCQKYQELHFLIGGEGPKRIILEEVRERYQLHDRVQLLGALEHKDVRNVL
VQGHIFLNTSLTEAFCMAIVEAASCGLQVVSTKVGGIPEVLPESLIILCEPSVKSLCDGL
EKAIFQVKSGTLPAPENIHNVVKTFYTWRNVAERTEKVYERVSKETVLPMHKRLDRLISH
CGPVTGYMFALLAVLSYLFLIFLQWMTPDSFIDVAIDATGPRRAWTHQWPRDKKRDENDK
ISQSR
NT seq 1458 nt NT seq  +upstreamnt  +downstreamnt
atggccaatagaagaggaggtgggcaaggccagcctccttcagtgtcgccttccccgggt
agctctggaaacctttccgacgataggacctgcacccataatatatgcatggtgtcagac
tttttctacccaaacatgggaggcgtggaaagccacatttaccagctctctcagtgcctc
attgagagagggcacaaggtcataactgtcacccatgcttatggaaatcgaaagggcgtc
cgttacctcaccaatggcctcaaagtttactatttgcctctgagagtcatgtacaaccaa
tctacagccacgactctctttcacagtctgccattgctcaggtacatatttgttcgggag
agaattacgataatccattcccacagttctttctctgccatggcccatgatgctctcttc
cacgccaagacaatggggcttcagacagtcttcacagaccattcccttttcggatttgct
gatgtcagctcggtgcttacaaacaagcttctaactgtgtctctttgtgacacaaaccac
atcatttgtgtctcttacactagtaaggagaacactgtactcagagcagcactgaatcct
gaaatagtgtccgtcattcctaacgctgtagatcctactgacttcactccagacccattt
aggaggcatgatagtgtaataactgttgttgttgtcagcagacttgtttacagaaaaggg
actgatttgcttagtggtataatacctgaactctgtcagaaataccaagaattacatttc
ctaattggaggagagggaccaaagagaatcattttggaagaagtacgggaaagataccaa
ctacatgacagggtgcagcttttgggagctttagaacacaaggatgttagaaatgtctta
gttcaaggacacatttttcttaacacctccctcactgaagcgttctgcatggccatcgtg
gaagctgccagttgtggtttgcaggtcgtcagcacaaaggttggtgggattcccgaagtc
cttccggaaagtcttattattctctgcgagccttcagtaaaatctttgtgtgacggtctg
gaaaaagccattttccaagtgaagtcggggacattgccagctccagaaaatatccacaat
gtagtgaagactttctacacctggcggaacgtggcagagagaactgaaaaggtgtatgag
cgagtgtcgaaggaaactgttttgccaatgcacaagagattggacaggctcatctcacac
tgtggccctgtgacgggctacatgtttgctttgctggctgtgctcagctatctcttcctc
attttcctgcagtggatgactccagactctttcattgatgttgcaatagatgctactggg
ccaaggagagcctggactcatcaatggcctcgtgataagaaaagagatgagaatgataag
atatcccaaagcaggtag

DBGET integrated database retrieval system