KEGG   Mus musculus (mouse): 18701
Entry
18701             CDS       T01002                                 

Gene name
Pigf
Definition
(RefSeq) phosphatidylinositol glycan anchor biosynthesis, class F
  KO
K05287  GPI ethanolamine phosphate transferase 2/3 subunit F
Organism
mmu  Mus musculus (mouse)
Pathway
mmu00563  Glycosylphosphatidylinositol (GPI)-anchor biosynthesis
mmu01100  Metabolic pathways
Module
mmu_M00065  GPI-anchor biosynthesis, core oligosaccharide
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00563 Glycosylphosphatidylinositol (GPI)-anchor biosynthesis
    18701 (Pigf)
SSDB
Motif
Pfam: PIG-F
Other DBs
NCBI-GeneID: 18701
NCBI-ProteinID: NP_032864
MGI: 99462
Ensembl: ENSMUSG00000024145
Vega: OTTMUSG00000024353
UniProt: O09101
Position
17 E4; 17 56.9 cM
AA seq 219 aa
MKDTDIKRLLYTNLLCVFSIFLSIFIPSFFVDNFSVLEAHLTWLCICSASVTTVNLLSYL
VVKPNVSSKRSSLSHKVTRALKCCVCFLMSCFLLHIIFVLYGAPLIELVLETFLFAVVLS
TFTTVPCLCLLGPNLKAWLRVFSRNGVTSIWENSLQITTISSFTGAWLGAFPIPLDWERP
WQVWPISCTLGATFGYVAGLVISPLWIYWNRKQLTYKNN
NT seq 660 nt   +upstreamnt  +downstreamnt
atgaaagatactgacatcaagagacttctgtataccaatcttttgtgcgtattttcaatt
ttcctaagcattttcattccgtccttcttcgtggacaacttctcagtattggaagctcat
ttgacctggctgtgtatctgctctgcttctgtgaccactgtcaatctcttgtcgtactta
gtagtgaaaccgaatgtgtcctctaaaagaagttcattgtcacataaggtaacgcgagct
ttgaaatgctgtgtctgcttccttatgtcttgttttctccttcacatcatttttgttcta
tatggagcaccactaatcgagttggtgctggaaacgtttttatttgcagttgttttgtct
acttttactacagtaccttgtctctgtttgttaggaccaaacctcaaagcatggctgaga
gttttcagtagaaatggagttacatctatttgggagaatagtcttcagatcactacaatt
tctagtttcacaggagcgtggcttggagcatttcctattccactggattgggaaagaccg
tggcaggtgtggcccatctcctgtacactcggagcgacctttggctacgtggctggcctg
gttatctcgccactctggatctactggaatagaaagcagcttacatacaagaacaattaa

DBGET integrated database retrieval system