KEGG   Mus musculus (mouse): 18706
Entry
18706             CDS       T01002                                 

Gene name
Pik3ca, 6330412C24Rik, caP, caPI3K, p110, p110alpha
Definition
(RefSeq) phosphatidylinositol-4,5-bisphosphate 3-kinase catalytic subunit alpha
  KO
K00922  phosphatidylinositol-4,5-bisphosphate 3-kinase catalytic subunit alpha/beta/delta [EC:2.7.1.153]
Organism
mmu  Mus musculus (mouse)
Pathway
mmu00562  Inositol phosphate metabolism
mmu01100  Metabolic pathways
mmu01521  EGFR tyrosine kinase inhibitor resistance
mmu01522  Endocrine resistance
mmu01524  Platinum drug resistance
mmu04012  ErbB signaling pathway
mmu04014  Ras signaling pathway
mmu04015  Rap1 signaling pathway
mmu04024  cAMP signaling pathway
mmu04062  Chemokine signaling pathway
mmu04066  HIF-1 signaling pathway
mmu04068  FoxO signaling pathway
mmu04070  Phosphatidylinositol signaling system
mmu04071  Sphingolipid signaling pathway
mmu04072  Phospholipase D signaling pathway
mmu04140  Autophagy - animal
mmu04150  mTOR signaling pathway
mmu04151  PI3K-Akt signaling pathway
mmu04152  AMPK signaling pathway
mmu04210  Apoptosis
mmu04211  Longevity regulating pathway
mmu04213  Longevity regulating pathway - multiple species
mmu04218  Cellular senescence
mmu04360  Axon guidance
mmu04370  VEGF signaling pathway
mmu04380  Osteoclast differentiation
mmu04510  Focal adhesion
mmu04550  Signaling pathways regulating pluripotency of stem cells
mmu04611  Platelet activation
mmu04613  Neutrophil extracellular trap formation
mmu04620  Toll-like receptor signaling pathway
mmu04625  C-type lectin receptor signaling pathway
mmu04630  JAK-STAT signaling pathway
mmu04650  Natural killer cell mediated cytotoxicity
mmu04660  T cell receptor signaling pathway
mmu04662  B cell receptor signaling pathway
mmu04664  Fc epsilon RI signaling pathway
mmu04666  Fc gamma R-mediated phagocytosis
mmu04668  TNF signaling pathway
mmu04670  Leukocyte transendothelial migration
mmu04722  Neurotrophin signaling pathway
mmu04725  Cholinergic synapse
mmu04750  Inflammatory mediator regulation of TRP channels
mmu04810  Regulation of actin cytoskeleton
mmu04910  Insulin signaling pathway
mmu04914  Progesterone-mediated oocyte maturation
mmu04915  Estrogen signaling pathway
mmu04917  Prolactin signaling pathway
mmu04919  Thyroid hormone signaling pathway
mmu04923  Regulation of lipolysis in adipocytes
mmu04926  Relaxin signaling pathway
mmu04929  GnRH secretion
mmu04930  Type II diabetes mellitus
mmu04931  Insulin resistance
mmu04932  Non-alcoholic fatty liver disease
mmu04933  AGE-RAGE signaling pathway in diabetic complications
mmu04935  Growth hormone synthesis, secretion and action
mmu04960  Aldosterone-regulated sodium reabsorption
mmu04973  Carbohydrate digestion and absorption
mmu05010  Alzheimer disease
mmu05017  Spinocerebellar ataxia
mmu05020  Prion disease
mmu05100  Bacterial invasion of epithelial cells
mmu05132  Salmonella infection
mmu05135  Yersinia infection
mmu05142  Chagas disease
mmu05146  Amoebiasis
mmu05160  Hepatitis C
mmu05161  Hepatitis B
mmu05162  Measles
mmu05163  Human cytomegalovirus infection
mmu05164  Influenza A
mmu05165  Human papillomavirus infection
mmu05166  Human T-cell leukemia virus 1 infection
mmu05167  Kaposi sarcoma-associated herpesvirus infection
mmu05168  Herpes simplex virus 1 infection
mmu05169  Epstein-Barr virus infection
mmu05170  Human immunodeficiency virus 1 infection
mmu05171  Coronavirus disease - COVID-19
mmu05200  Pathways in cancer
mmu05203  Viral carcinogenesis
mmu05205  Proteoglycans in cancer
mmu05206  MicroRNAs in cancer
mmu05210  Colorectal cancer
mmu05211  Renal cell carcinoma
mmu05212  Pancreatic cancer
mmu05213  Endometrial cancer
mmu05214  Glioma
mmu05215  Prostate cancer
mmu05218  Melanoma
mmu05220  Chronic myeloid leukemia
mmu05221  Acute myeloid leukemia
mmu05222  Small cell lung cancer
mmu05223  Non-small cell lung cancer
mmu05224  Breast cancer
mmu05225  Hepatocellular carcinoma
mmu05226  Gastric cancer
mmu05230  Central carbon metabolism in cancer
mmu05231  Choline metabolism in cancer
mmu05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
mmu05415  Diabetic cardiomyopathy
mmu05417  Lipid and atherosclerosis
mmu05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    18706 (Pik3ca)
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    18706 (Pik3ca)
   04014 Ras signaling pathway
    18706 (Pik3ca)
   04015 Rap1 signaling pathway
    18706 (Pik3ca)
   04370 VEGF signaling pathway
    18706 (Pik3ca)
   04630 JAK-STAT signaling pathway
    18706 (Pik3ca)
   04668 TNF signaling pathway
    18706 (Pik3ca)
   04066 HIF-1 signaling pathway
    18706 (Pik3ca)
   04068 FoxO signaling pathway
    18706 (Pik3ca)
   04070 Phosphatidylinositol signaling system
    18706 (Pik3ca)
   04072 Phospholipase D signaling pathway
    18706 (Pik3ca)
   04071 Sphingolipid signaling pathway
    18706 (Pik3ca)
   04024 cAMP signaling pathway
    18706 (Pik3ca)
   04151 PI3K-Akt signaling pathway
    18706 (Pik3ca)
   04152 AMPK signaling pathway
    18706 (Pik3ca)
   04150 mTOR signaling pathway
    18706 (Pik3ca)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    18706 (Pik3ca)
  09143 Cell growth and death
   04210 Apoptosis
    18706 (Pik3ca)
   04218 Cellular senescence
    18706 (Pik3ca)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    18706 (Pik3ca)
   04550 Signaling pathways regulating pluripotency of stem cells
    18706 (Pik3ca)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    18706 (Pik3ca)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    18706 (Pik3ca)
   04613 Neutrophil extracellular trap formation
    18706 (Pik3ca)
   04620 Toll-like receptor signaling pathway
    18706 (Pik3ca)
   04625 C-type lectin receptor signaling pathway
    18706 (Pik3ca)
   04650 Natural killer cell mediated cytotoxicity
    18706 (Pik3ca)
   04660 T cell receptor signaling pathway
    18706 (Pik3ca)
   04662 B cell receptor signaling pathway
    18706 (Pik3ca)
   04664 Fc epsilon RI signaling pathway
    18706 (Pik3ca)
   04666 Fc gamma R-mediated phagocytosis
    18706 (Pik3ca)
   04670 Leukocyte transendothelial migration
    18706 (Pik3ca)
   04062 Chemokine signaling pathway
    18706 (Pik3ca)
  09152 Endocrine system
   04910 Insulin signaling pathway
    18706 (Pik3ca)
   04923 Regulation of lipolysis in adipocytes
    18706 (Pik3ca)
   04929 GnRH secretion
    18706 (Pik3ca)
   04915 Estrogen signaling pathway
    18706 (Pik3ca)
   04914 Progesterone-mediated oocyte maturation
    18706 (Pik3ca)
   04917 Prolactin signaling pathway
    18706 (Pik3ca)
   04926 Relaxin signaling pathway
    18706 (Pik3ca)
   04935 Growth hormone synthesis, secretion and action
    18706 (Pik3ca)
   04919 Thyroid hormone signaling pathway
    18706 (Pik3ca)
  09154 Digestive system
   04973 Carbohydrate digestion and absorption
    18706 (Pik3ca)
  09155 Excretory system
   04960 Aldosterone-regulated sodium reabsorption
    18706 (Pik3ca)
  09156 Nervous system
   04725 Cholinergic synapse
    18706 (Pik3ca)
   04722 Neurotrophin signaling pathway
    18706 (Pik3ca)
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    18706 (Pik3ca)
  09158 Development and regeneration
   04360 Axon guidance
    18706 (Pik3ca)
   04380 Osteoclast differentiation
    18706 (Pik3ca)
  09149 Aging
   04211 Longevity regulating pathway
    18706 (Pik3ca)
   04213 Longevity regulating pathway - multiple species
    18706 (Pik3ca)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    18706 (Pik3ca)
   05206 MicroRNAs in cancer
    18706 (Pik3ca)
   05205 Proteoglycans in cancer
    18706 (Pik3ca)
   05203 Viral carcinogenesis
    18706 (Pik3ca)
   05230 Central carbon metabolism in cancer
    18706 (Pik3ca)
   05231 Choline metabolism in cancer
    18706 (Pik3ca)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    18706 (Pik3ca)
  09162 Cancer: specific types
   05210 Colorectal cancer
    18706 (Pik3ca)
   05212 Pancreatic cancer
    18706 (Pik3ca)
   05225 Hepatocellular carcinoma
    18706 (Pik3ca)
   05226 Gastric cancer
    18706 (Pik3ca)
   05214 Glioma
    18706 (Pik3ca)
   05221 Acute myeloid leukemia
    18706 (Pik3ca)
   05220 Chronic myeloid leukemia
    18706 (Pik3ca)
   05218 Melanoma
    18706 (Pik3ca)
   05211 Renal cell carcinoma
    18706 (Pik3ca)
   05215 Prostate cancer
    18706 (Pik3ca)
   05213 Endometrial cancer
    18706 (Pik3ca)
   05224 Breast cancer
    18706 (Pik3ca)
   05222 Small cell lung cancer
    18706 (Pik3ca)
   05223 Non-small cell lung cancer
    18706 (Pik3ca)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    18706 (Pik3ca)
   05170 Human immunodeficiency virus 1 infection
    18706 (Pik3ca)
   05161 Hepatitis B
    18706 (Pik3ca)
   05160 Hepatitis C
    18706 (Pik3ca)
   05171 Coronavirus disease - COVID-19
    18706 (Pik3ca)
   05164 Influenza A
    18706 (Pik3ca)
   05162 Measles
    18706 (Pik3ca)
   05168 Herpes simplex virus 1 infection
    18706 (Pik3ca)
   05163 Human cytomegalovirus infection
    18706 (Pik3ca)
   05167 Kaposi sarcoma-associated herpesvirus infection
    18706 (Pik3ca)
   05169 Epstein-Barr virus infection
    18706 (Pik3ca)
   05165 Human papillomavirus infection
    18706 (Pik3ca)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    18706 (Pik3ca)
   05135 Yersinia infection
    18706 (Pik3ca)
   05100 Bacterial invasion of epithelial cells
    18706 (Pik3ca)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    18706 (Pik3ca)
   05142 Chagas disease
    18706 (Pik3ca)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    18706 (Pik3ca)
   05017 Spinocerebellar ataxia
    18706 (Pik3ca)
   05020 Prion disease
    18706 (Pik3ca)
  09166 Cardiovascular disease
   05417 Lipid and atherosclerosis
    18706 (Pik3ca)
   05418 Fluid shear stress and atherosclerosis
    18706 (Pik3ca)
   05415 Diabetic cardiomyopathy
    18706 (Pik3ca)
  09167 Endocrine and metabolic disease
   04930 Type II diabetes mellitus
    18706 (Pik3ca)
   04932 Non-alcoholic fatty liver disease
    18706 (Pik3ca)
   04931 Insulin resistance
    18706 (Pik3ca)
   04933 AGE-RAGE signaling pathway in diabetic complications
    18706 (Pik3ca)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    18706 (Pik3ca)
   01524 Platinum drug resistance
    18706 (Pik3ca)
   01522 Endocrine resistance
    18706 (Pik3ca)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:mmu04131]
    18706 (Pik3ca)
Enzymes [BR:mmu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.153  phosphatidylinositol-4,5-bisphosphate 3-kinase
     18706 (Pik3ca)
Membrane trafficking [BR:mmu04131]
 Endocytosis
  Rab GTPases and associated proteins
   Rab associated proteins
    18706 (Pik3ca)
SSDB
Motif
Pfam: PI3Ka PI3_PI4_kinase PI3K_rbd PI3K_C2 PI3K_p85B DUF2321 ABC1 Ribosomal_S15
Other DBs
NCBI-GeneID: 18706
NCBI-ProteinID: NP_032865
MGI: 1206581
Ensembl: ENSMUSG00000027665
Vega: OTTMUSG00000021191
UniProt: P42337
Structure
PDB: 
4A55

Position
3 A3; 3 15.7 cM
AA seq 1068 aa
MPPRPSSGELWGIHLMPPRILVECLLPNGMIVTLECLREATLVTIKHELFREARKYPLHQ
LLQDETSYIFVSVTQEAEREEFFDETRRLCDLRLFQPFLKVIEPVGNREEKILNREIGFV
IGMPVCEFDMVKDPEVQDFRRNILNVCKEAVDLRDLNSPHSRAMYVYPPNVESSPELPKH
IYNKLDKGQIIVVIWVIVSPNNDKQKYTLKINHDCVPEQVIAEAIRKKTRSMLLSSEQLK
LCVLEYQGKYILKVCGCDEYFLEKYPLSQYKYIRSCIMLGRMPNLMLMAKESLYSQLPID
SFTMPSYSRRISTATPYMNGETSTKSLWVINSALRIKILCATYVNVNIRDIDKIYVRTGI
YHGGEPLCDNVNTQRVPCSNPRWNEWLNYDIYIPDLPRAARLCLSICSVKGRKGAKEEHC
PLAWGNINLFDYTDTLVSGKMALNLWPVPHGLEDLLNPIGVTGSNPNKETPCLELEFDWF
SSVVKFPDMSVIEEHANWSVSREAGFSYSHTGLSNRLARDNELRENDKEQLRALCTRDPL
SEITEQEKDFLWSHRHYCVTIPEILPKLLLSVKWNSRDEVAQMYCLVKDWPPIKPEQAME
LLDCNYPDPMVRSFAVRCLEKYLTDDKLSQYLIQLVQVLKYEQYLDNLLVRFLLKKALTN
QRIGHFFFWHLKSEMHNKTVSQRFGLLLESYCRACGMYLKHLNRQVEAMEKLINLTDILK
QEKKDETQKVQMKFLVEQMRQPDFMDALQGFLSPLNPAHQLGNLRLEECRIMSSAKRPLW
LNWENPDIMSELLFQNNEIIFKNGDDLRQDMLTLQIIRIMENIWQNQGLDLRMLPYGCLS
IGDCVGLIEVVRNSHTIMQIQCKGGLKGALQFNSHTLHQWLKDKNKGEIYDAAIDLFTRS
CAGYCVATFILGIGDRHNSNIMVKDDGQLFHIDFGHFLDHKKKKFGYKRERVPFVLTQDF
LIVISKGAQEYTKTREFERFQEMCYKAYLAIRQHANLFINLFSMMLGSGMPELQSFDDIA
YIRKTLALDKTEQEALEYFTKQMNDAHHGGWTTKMDWIFHTIKQHALN
NT seq 3207 nt   +upstreamnt  +downstreamnt
atgcctccacgaccatcttcgggtgaactgtggggcatccacttgatgcccccacgaatc
ctagtggaatgtttactccccaatggaatgatagtgactttagaatgcctccgtgaggcc
acactcgtcaccatcaaacatgaactgttcagagaggccaggaaataccctctccatcag
cttctgcaagacgaaacttcttacattttcgtaagtgtcacccaagaagcagaaagggaa
gaattttttgatgaaacaagacgactttgtgaccttcggctttttcaaccctttttaaaa
gttattgaaccagtaggcaaccgtgaagaaaagatcctcaatcgagaaattggttttgtt
attggcatgccagtgtgtgaatttgatatggttaaagatccagaagtccaagactttcga
aggaacattctgaatgtttgcaaagaagctgtggacctgcgggatctcaactcgcctcat
agcagagcaatgtatgtctaccctccaaatgtcgagtcttccccagaactgccaaagcac
atctacaacaagttagataaaggacaaatcatagtggtgatttgggtaatagtctctcca
aacaacgacaagcagaagtacactctgaagatcaatcatgactgtgtgccagagcaagtc
attgctgaagccatcaggaaaaagactcggagcatgttgttgtcctctgagcagctgaaa
ctctgtgtcttagaatatcagggcaagtatattctgaaagtgtgtggctgtgacgaatac
ttcctggaaaagtaccctctgagtcagtacaagtacataagaagctgtataatgctgggg
aggatgcccaacttgatgctgatggccaaagaaagcctatactctcagctgccgattgat
agcttcaccatgccgtcatactccaggcgcatctccacagccacaccctacatgaatgga
gagacatctacgaaatccctctgggtcataaatagtgcgctcagaataaaaattctttgt
gcaacctatgtaaatgtaaatattcgagacattgataagatctatgttcgaacaggtatc
taccatggaggagaacccttatgtgacaatgtgaacactcaaagagtaccttgttccaat
cctaggtggaatgaatggctgaattatgatatatacattcctgatcttcctcgtgctgcg
cgcctttgcctttcaatctgctctgttaaaggccgaaagggtgctaaggaggagcactgt
ccgttggcctggggaaacataaacttgtttgattatacagacaccctagtgtccgggaaa
atggctttgaatctctggcctgtaccgcatgggttagaagatctgctgaaccctattggt
gttactgggtcaaatccaaataaagaaactccatgcttagagttggagtttgattggttc
agcagtgtggtgaagtttccagacatgtctgtgatcgaagaacatgccaattggtccgtg
tcccgagaagctggattcagttactcccatacaggactgagtaacagactagccagagac
aatgagttaagagaaaatgacaaggaacagctccgagcactttgcacccgggacccacta
tctgaaatcactgaacaagagaaagacttcctatggagccacagacactactgcgtaact
attcctgaaatcctacccaaattgcttctgtctgtcaagtggaattccagagacgaagtg
gcccagatgtactgcttagtaaaagattggcctccaatcaaaccagagcaagccatggaa
ctcctggactgtaactatccagatcctatggttcggagttttgctgttcggtgcttagaa
aaatatttaacagatgacaaactttctcagtacctcattcaacttgtacaggtcttaaaa
tatgaacagtatttggataacctgcttgtgagatttttactcaagaaagcattgacaaat
caaaggattggccattttttcttttggcatttaaaatctgagatgcacaataagactgtc
agtcagaggtttggcctgctattggagtcctactgccgtgcctgtgggatgtatctgaag
cacctgaacagacaagtagaggccatggagaagctcatcaacctaacggacatccttaag
caggagaagaaggatgagacacaaaaggtacagatgaagtttttggttgaacagatgaga
cagccagacttcatggatgctttgcagggttttctgtcccctctgaatcctgctcaccaa
ctaggaaacctcaggcttgaagagtgtcgaattatgtcctctgcaaaaaggccactgtgg
ttgaattgggagaacccagacatcatgtcagagctactgtttcagaacaatgagatcatc
tttaaaaatggcgacgacttacggcaagatatgttaacccttcagatcatccgaatcatg
gagaacatctggcaaaaccaaggccttgaccttcgcatgctaccttatggctgtctatcc
attggggactgtgtgggtctcatcgaggtggtgagaaactctcacaccatcatgcaaatc
cagtgcaaaggaggcctgaagggggcgctgcagttcaacagccacacactgcatcaatgg
ctcaaggacaagaacaagggcgagatatatgatgcagccattgacctgttcactcggtcc
tgcgctgggtactgcgtggcaacctttatcttgggaattggagaccggcacaacagcaac
atcatggtgaaagatgacggacagctgtttcatatagattttgggcactttttggatcac
aagaagaaaaaatttggctataagcgggaacgtgtgccatttgtgttgacacaggatttc
ttgattgtgattagtaagggagcacaagagtacaccaagaccagagagtttgagaggttt
caggagatgtgttacaaggcttacctagcaattcggcagcatgccaatctcttcatcaac
cttttttcaatgatgcttggctctggaatgccagaactacaatcttttgatgacattgca
tatatccgaaagactctagccttggacaaaactgagcaagaagctttggaatatttcaca
aagcaaatgaatgatgcacatcatggtggatggacgacaaaaatggattggatcttccac
accatcaagcagcatgctttgaactga

KEGG   Mus musculus (mouse): 18707
Entry
18707             CDS       T01002                                 

Gene name
Pik3cd, 2410099E07Rik, 2610208K16Rik, AW545373, p110de, p110delta
Definition
(RefSeq) phosphatidylinositol-4,5-bisphosphate 3-kinase catalytic subunit delta
  KO
K00922  phosphatidylinositol-4,5-bisphosphate 3-kinase catalytic subunit alpha/beta/delta [EC:2.7.1.153]
Organism
mmu  Mus musculus (mouse)
Pathway
mmu00562  Inositol phosphate metabolism
mmu01100  Metabolic pathways
mmu01521  EGFR tyrosine kinase inhibitor resistance
mmu01522  Endocrine resistance
mmu01524  Platinum drug resistance
mmu04012  ErbB signaling pathway
mmu04014  Ras signaling pathway
mmu04015  Rap1 signaling pathway
mmu04024  cAMP signaling pathway
mmu04062  Chemokine signaling pathway
mmu04066  HIF-1 signaling pathway
mmu04068  FoxO signaling pathway
mmu04070  Phosphatidylinositol signaling system
mmu04071  Sphingolipid signaling pathway
mmu04072  Phospholipase D signaling pathway
mmu04140  Autophagy - animal
mmu04150  mTOR signaling pathway
mmu04151  PI3K-Akt signaling pathway
mmu04152  AMPK signaling pathway
mmu04210  Apoptosis
mmu04211  Longevity regulating pathway
mmu04213  Longevity regulating pathway - multiple species
mmu04218  Cellular senescence
mmu04360  Axon guidance
mmu04370  VEGF signaling pathway
mmu04380  Osteoclast differentiation
mmu04510  Focal adhesion
mmu04550  Signaling pathways regulating pluripotency of stem cells
mmu04611  Platelet activation
mmu04613  Neutrophil extracellular trap formation
mmu04620  Toll-like receptor signaling pathway
mmu04625  C-type lectin receptor signaling pathway
mmu04630  JAK-STAT signaling pathway
mmu04650  Natural killer cell mediated cytotoxicity
mmu04660  T cell receptor signaling pathway
mmu04662  B cell receptor signaling pathway
mmu04664  Fc epsilon RI signaling pathway
mmu04666  Fc gamma R-mediated phagocytosis
mmu04668  TNF signaling pathway
mmu04670  Leukocyte transendothelial migration
mmu04722  Neurotrophin signaling pathway
mmu04725  Cholinergic synapse
mmu04750  Inflammatory mediator regulation of TRP channels
mmu04810  Regulation of actin cytoskeleton
mmu04910  Insulin signaling pathway
mmu04914  Progesterone-mediated oocyte maturation
mmu04915  Estrogen signaling pathway
mmu04917  Prolactin signaling pathway
mmu04919  Thyroid hormone signaling pathway
mmu04923  Regulation of lipolysis in adipocytes
mmu04926  Relaxin signaling pathway
mmu04929  GnRH secretion
mmu04930  Type II diabetes mellitus
mmu04931  Insulin resistance
mmu04932  Non-alcoholic fatty liver disease
mmu04933  AGE-RAGE signaling pathway in diabetic complications
mmu04935  Growth hormone synthesis, secretion and action
mmu04960  Aldosterone-regulated sodium reabsorption
mmu04973  Carbohydrate digestion and absorption
mmu05010  Alzheimer disease
mmu05017  Spinocerebellar ataxia
mmu05020  Prion disease
mmu05100  Bacterial invasion of epithelial cells
mmu05132  Salmonella infection
mmu05135  Yersinia infection
mmu05142  Chagas disease
mmu05146  Amoebiasis
mmu05160  Hepatitis C
mmu05161  Hepatitis B
mmu05162  Measles
mmu05163  Human cytomegalovirus infection
mmu05164  Influenza A
mmu05165  Human papillomavirus infection
mmu05166  Human T-cell leukemia virus 1 infection
mmu05167  Kaposi sarcoma-associated herpesvirus infection
mmu05168  Herpes simplex virus 1 infection
mmu05169  Epstein-Barr virus infection
mmu05170  Human immunodeficiency virus 1 infection
mmu05171  Coronavirus disease - COVID-19
mmu05200  Pathways in cancer
mmu05203  Viral carcinogenesis
mmu05205  Proteoglycans in cancer
mmu05206  MicroRNAs in cancer
mmu05210  Colorectal cancer
mmu05211  Renal cell carcinoma
mmu05212  Pancreatic cancer
mmu05213  Endometrial cancer
mmu05214  Glioma
mmu05215  Prostate cancer
mmu05218  Melanoma
mmu05220  Chronic myeloid leukemia
mmu05221  Acute myeloid leukemia
mmu05222  Small cell lung cancer
mmu05223  Non-small cell lung cancer
mmu05224  Breast cancer
mmu05225  Hepatocellular carcinoma
mmu05226  Gastric cancer
mmu05230  Central carbon metabolism in cancer
mmu05231  Choline metabolism in cancer
mmu05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
mmu05415  Diabetic cardiomyopathy
mmu05417  Lipid and atherosclerosis
mmu05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    18707 (Pik3cd)
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    18707 (Pik3cd)
   04014 Ras signaling pathway
    18707 (Pik3cd)
   04015 Rap1 signaling pathway
    18707 (Pik3cd)
   04370 VEGF signaling pathway
    18707 (Pik3cd)
   04630 JAK-STAT signaling pathway
    18707 (Pik3cd)
   04668 TNF signaling pathway
    18707 (Pik3cd)
   04066 HIF-1 signaling pathway
    18707 (Pik3cd)
   04068 FoxO signaling pathway
    18707 (Pik3cd)
   04070 Phosphatidylinositol signaling system
    18707 (Pik3cd)
   04072 Phospholipase D signaling pathway
    18707 (Pik3cd)
   04071 Sphingolipid signaling pathway
    18707 (Pik3cd)
   04024 cAMP signaling pathway
    18707 (Pik3cd)
   04151 PI3K-Akt signaling pathway
    18707 (Pik3cd)
   04152 AMPK signaling pathway
    18707 (Pik3cd)
   04150 mTOR signaling pathway
    18707 (Pik3cd)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    18707 (Pik3cd)
  09143 Cell growth and death
   04210 Apoptosis
    18707 (Pik3cd)
   04218 Cellular senescence
    18707 (Pik3cd)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    18707 (Pik3cd)
   04550 Signaling pathways regulating pluripotency of stem cells
    18707 (Pik3cd)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    18707 (Pik3cd)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    18707 (Pik3cd)
   04613 Neutrophil extracellular trap formation
    18707 (Pik3cd)
   04620 Toll-like receptor signaling pathway
    18707 (Pik3cd)
   04625 C-type lectin receptor signaling pathway
    18707 (Pik3cd)
   04650 Natural killer cell mediated cytotoxicity
    18707 (Pik3cd)
   04660 T cell receptor signaling pathway
    18707 (Pik3cd)
   04662 B cell receptor signaling pathway
    18707 (Pik3cd)
   04664 Fc epsilon RI signaling pathway
    18707 (Pik3cd)
   04666 Fc gamma R-mediated phagocytosis
    18707 (Pik3cd)
   04670 Leukocyte transendothelial migration
    18707 (Pik3cd)
   04062 Chemokine signaling pathway
    18707 (Pik3cd)
  09152 Endocrine system
   04910 Insulin signaling pathway
    18707 (Pik3cd)
   04923 Regulation of lipolysis in adipocytes
    18707 (Pik3cd)
   04929 GnRH secretion
    18707 (Pik3cd)
   04915 Estrogen signaling pathway
    18707 (Pik3cd)
   04914 Progesterone-mediated oocyte maturation
    18707 (Pik3cd)
   04917 Prolactin signaling pathway
    18707 (Pik3cd)
   04926 Relaxin signaling pathway
    18707 (Pik3cd)
   04935 Growth hormone synthesis, secretion and action
    18707 (Pik3cd)
   04919 Thyroid hormone signaling pathway
    18707 (Pik3cd)
  09154 Digestive system
   04973 Carbohydrate digestion and absorption
    18707 (Pik3cd)
  09155 Excretory system
   04960 Aldosterone-regulated sodium reabsorption
    18707 (Pik3cd)
  09156 Nervous system
   04725 Cholinergic synapse
    18707 (Pik3cd)
   04722 Neurotrophin signaling pathway
    18707 (Pik3cd)
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    18707 (Pik3cd)
  09158 Development and regeneration
   04360 Axon guidance
    18707 (Pik3cd)
   04380 Osteoclast differentiation
    18707 (Pik3cd)
  09149 Aging
   04211 Longevity regulating pathway
    18707 (Pik3cd)
   04213 Longevity regulating pathway - multiple species
    18707 (Pik3cd)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    18707 (Pik3cd)
   05206 MicroRNAs in cancer
    18707 (Pik3cd)
   05205 Proteoglycans in cancer
    18707 (Pik3cd)
   05203 Viral carcinogenesis
    18707 (Pik3cd)
   05230 Central carbon metabolism in cancer
    18707 (Pik3cd)
   05231 Choline metabolism in cancer
    18707 (Pik3cd)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    18707 (Pik3cd)
  09162 Cancer: specific types
   05210 Colorectal cancer
    18707 (Pik3cd)
   05212 Pancreatic cancer
    18707 (Pik3cd)
   05225 Hepatocellular carcinoma
    18707 (Pik3cd)
   05226 Gastric cancer
    18707 (Pik3cd)
   05214 Glioma
    18707 (Pik3cd)
   05221 Acute myeloid leukemia
    18707 (Pik3cd)
   05220 Chronic myeloid leukemia
    18707 (Pik3cd)
   05218 Melanoma
    18707 (Pik3cd)
   05211 Renal cell carcinoma
    18707 (Pik3cd)
   05215 Prostate cancer
    18707 (Pik3cd)
   05213 Endometrial cancer
    18707 (Pik3cd)
   05224 Breast cancer
    18707 (Pik3cd)
   05222 Small cell lung cancer
    18707 (Pik3cd)
   05223 Non-small cell lung cancer
    18707 (Pik3cd)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    18707 (Pik3cd)
   05170 Human immunodeficiency virus 1 infection
    18707 (Pik3cd)
   05161 Hepatitis B
    18707 (Pik3cd)
   05160 Hepatitis C
    18707 (Pik3cd)
   05171 Coronavirus disease - COVID-19
    18707 (Pik3cd)
   05164 Influenza A
    18707 (Pik3cd)
   05162 Measles
    18707 (Pik3cd)
   05168 Herpes simplex virus 1 infection
    18707 (Pik3cd)
   05163 Human cytomegalovirus infection
    18707 (Pik3cd)
   05167 Kaposi sarcoma-associated herpesvirus infection
    18707 (Pik3cd)
   05169 Epstein-Barr virus infection
    18707 (Pik3cd)
   05165 Human papillomavirus infection
    18707 (Pik3cd)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    18707 (Pik3cd)
   05135 Yersinia infection
    18707 (Pik3cd)
   05100 Bacterial invasion of epithelial cells
    18707 (Pik3cd)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    18707 (Pik3cd)
   05142 Chagas disease
    18707 (Pik3cd)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    18707 (Pik3cd)
   05017 Spinocerebellar ataxia
    18707 (Pik3cd)
   05020 Prion disease
    18707 (Pik3cd)
  09166 Cardiovascular disease
   05417 Lipid and atherosclerosis
    18707 (Pik3cd)
   05418 Fluid shear stress and atherosclerosis
    18707 (Pik3cd)
   05415 Diabetic cardiomyopathy
    18707 (Pik3cd)
  09167 Endocrine and metabolic disease
   04930 Type II diabetes mellitus
    18707 (Pik3cd)
   04932 Non-alcoholic fatty liver disease
    18707 (Pik3cd)
   04931 Insulin resistance
    18707 (Pik3cd)
   04933 AGE-RAGE signaling pathway in diabetic complications
    18707 (Pik3cd)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    18707 (Pik3cd)
   01524 Platinum drug resistance
    18707 (Pik3cd)
   01522 Endocrine resistance
    18707 (Pik3cd)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:mmu04131]
    18707 (Pik3cd)
Enzymes [BR:mmu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.153  phosphatidylinositol-4,5-bisphosphate 3-kinase
     18707 (Pik3cd)
Membrane trafficking [BR:mmu04131]
 Endocytosis
  Rab GTPases and associated proteins
   Rab associated proteins
    18707 (Pik3cd)
SSDB
Motif
Pfam: PI3_PI4_kinase PI3Ka PI3K_p85B PI3K_rbd PI3K_C2 DUF4135
Other DBs
NCBI-GeneID: 18707
NCBI-ProteinID: NP_001157524
MGI: 1098211
Ensembl: ENSMUSG00000039936
Vega: OTTMUSG00000010264
UniProt: O35904
Structure
PDB: 

Position
4; 4 E2
AA seq 1043 aa
MPPGVDCPMEFWTKEESQSVVVDFLLPTGVYLNFPVSRNANLSTIKQVLWHRAQYEPLFH
MLSDPEAYVFTCVNQTAEQQELEDEQRRLCDIQPFLPVLRLVAREGDRVKKLINSQISLL
IGKGLHEFDSLRDPEVNDFRTKMRQFCEEAAAHRQQLGWVEWLQYSFPLQLEPSARGWRA
GLLRVSNRALLVNVKFEGSEESFTFQVSTKDMPLALMACALRKKATVFRQPLVEQPEEYA
LQVNGRHEYLYGNYPLCHFQYICSCLHSGLTPHLTMVHSSSILAMRDEQSNPAPQVQKPR
AKPPPIPAKKPSSVSLWSLEQPFSIELIEGRKVNADERMKLVVQAGLFHGNEMLCKTVSS
SEVNVCSEPVWKQRLEFDISVCDLPRMARLCFALYAVVEKAKKARSTKKKSKKADCPIAW
ANLMLFDYKDQLKTGERCLYMWPSVPDEKGELLNPAGTVRGNPNTESAAALVIYLPEVAP
HPVYFPALEKILELGRHGERGRITEEELQLREILERRGSGELYEHEKDLVWKMRHEVQEH
FPEALARLLLVTKWNKHEDVAQMLYLLCSWPELPVLSALELLDFSFPDCYVGSFAIKSLR
KLTDDELFQYLLQLVQVLKYESYLDCELTKFLLGRALANRKIGHFLFWHLRSEMHVPSVA
LRFGLIMEAYCRGSTHHMKVLMKQGEALSKLKALNDFVKVSSQKTTKPQTKEMMHMCMRQ
ETYMEALSHLQSPLDPSTLLEEVCVEQCTFMDSKMKPLWIMYSSEEAGSAGNVGIIFKNG
DDLRQDMLTLQMIQLMDVLWKQEGLDLRMTPYGCLPTGDRTGLIEVVLHSDTIANIQLNK
SNMAATAAFNKDALLNWLKSKNPGEALDRAIEEFTLSCAGYCVATYVLGIGDRHSDNIMI
RESGQLFHIDFGHFLGNFKTKFGINRERVPFILTYDFVHVIQQGKTNNSEKFERFRGYCE
RAYTILRRHGLLFLHLFALMRAAGLPELSCSKDIQYLKDSLALGKTEEEALKHFRVKFNE
ALRESWKTKVNWLAHNVSKDNRQ
NT seq 3132 nt   +upstreamnt  +downstreamnt
atgccccctggggtggactgccccatggagttctggaccaaagaggagagccagagcgtg
gttgttgacttcttgctgcccacaggggtctacttgaacttccccgtgtcccgcaatgcc
aacctcagcaccatcaagcaggtgctgtggcaccgtgcacagtatgagccactcttccac
atgctcagtgaccccgaggcctatgtgttcacctgtgtgaaccagacggcggagcagcag
gagttggaggatgagcagcggaggctgtgcgacatccagcccttcctgcccgtgctgcgc
ctcgtggcccgagagggggaccgcgtgaagaagctcattaactcccagatcagcctcctc
attggcaaaggtctccatgagtttgattccctgcgggacccggaagtaaacgacttccgc
actaagatgcgccagttttgtgaagaggctgctgctcaccgccagcagctgggctgggtg
gaatggctgcagtacagcttccccctgcagctggagccctcagcaaggggttggcgggcc
ggcttattgcgtgtcagcaaccgagccctgctggtcaacgtgaagttcgagggcagtgag
gagagcttcaccttccaggtatccaccaaggacatgcccctggcactgatggcctgtgcc
ctccgaaaaaaggccacagtgttccggcagcctctggtggagcagcctgaggaatatgcc
ctgcaggtgaacgggaggcacgaatacctctacggcaactacccgctctgccactttcag
tacatctgcagctgcctacacagcgggctgacccctcatctgaccatggtccactcctcc
tccatccttgctatgcgggatgagcagagcaatcctgccccccaagtacagaaaccacgt
gccaaacctcccccgatccctgccaagaagccctcctctgtgtccctgtggtccctggaa
cagccattctccattgagctgatcgagggccgaaaagtgaatgctgacgagcggatgaag
ctggttgttcaggccgggctcttccatggcaatgagatgctgtgcaagactgtgtcaagc
tcggaggtgaatgtatgctcagagcccgtgtggaagcagcgactggagttcgatatcagc
gtctgtgacctcccgcgcatggctcgactctgttttgctctctatgccgtcgtggagaag
gctaagaaggcacgctccacaaagaagaagtctaagaaggcggactgccccatcgcttgg
gccaacctcatgctattcgactacaaagatcagctcaagacgggggagcgctgcctctac
atgtggccctctgtcccagatgagaagggagagctgctgaatcctgcgggtacagtgcgc
gggaaccccaacacggagagtgccgctgccctggtcatctacctgcctgaggtggccccc
caccctgtgtacttccccgctctggagaagatcctggagctggggcgtcacggggagcgt
gggcgcatcacggaggaggagctgcagctgcgggagatcctggaacggcggggatccggg
gaactgtacgaacatgagaaggacctggtgtggaagatgcgccacgaagtccaggagcat
ttcccagaggcgctggcccgcctgctgctggtcaccaagtggaataaacacgaggatgtg
gcccagatgctctatttgctgtgctcctggcccgagctgcctgtgctgagcgccctggaa
cttctggactttagctttcccgactgctacgtgggctccttcgccatcaagtcccttcgg
aagctgacggacgatgagctcttccagtaccttctgcagctggtgcaagtgctcaaatat
gagtcctacctggactgcgagctgaccaaattcttgctgggccgagccctggctaaccgc
aagatcggacacttcctgttctggcacctccgctctgagatgcacgtaccatcagtggct
ctgcggtttggtctcatcatggaagcctactgcagaggcagcacccaccacatgaaggtg
ctgatgaagcagggggaagcactgagcaagcttaaggcactgaatgactttgtgaaggtg
agttcccagaagaccaccaagccccaaaccaaggagatgatgcatatgtgcatgcgccag
gagacctacatggaggccctgtcccacctgcagtctccactcgaccccagcaccctgctg
gaggaagtctgtgtggagcagtgcaccttcatggactccaaaatgaagcccctgtggatc
atgtacagcagcgaggaggcgggcagtgctggcaacgtgggcatcatctttaagaacggg
gatgacctccgccaggacatgctgactctgcagatgatccagctcatggacgtcctgtgg
aagcaggagggcctggacctgaggatgacgccctacggctgcctccccaccggggaccgc
acaggtctcatcgaggtggtcctccactcggacaccatcgccaacatccagctgaacaaa
agcaacatggcggccacagctgccttcaacaaggacgccctgctcaactggctcaagtcc
aagaaccctggggaggccctggatcgggccattgaggaattcaccctctcctgtgctggc
tactgtgtggccacatatgttctgggcatcggtgaccggcacagcgacaacatcatgatc
agagagagtgggcagctcttccacattgattttggccactttctggggaacttcaagacc
aagtttggaatcaaccgagagcgcgtccccttcattctcacctacgactttgtccacgtg
atccagcaggggaagactaacaacagtgagaagtttgaaaggttccgcggctactgtgaa
cgagcctataccatcctgcggcgccacgggctgcttttcctccatctcttcgccctgatg
cgggccgcaggtctgcctgagcttagctgctccaaagatatccagtatctcaaggactct
ctggcactggggaagacggaggaagaggcgctaaagcacttccgggtgaagttcaacgaa
gctctccgagaaagctggaaaaccaaagtcaactggctggcgcacaatgtgtccaaggat
aaccgacagtag

KEGG   Mus musculus (mouse): 74769
Entry
74769             CDS       T01002                                 

Gene name
Pik3cb, 1110001J02Rik, AI447572, p110be, p110beta
Definition
(RefSeq) phosphatidylinositol-4,5-bisphosphate 3-kinase catalytic subunit beta
  KO
K00922  phosphatidylinositol-4,5-bisphosphate 3-kinase catalytic subunit alpha/beta/delta [EC:2.7.1.153]
Organism
mmu  Mus musculus (mouse)
Pathway
mmu00562  Inositol phosphate metabolism
mmu01100  Metabolic pathways
mmu01521  EGFR tyrosine kinase inhibitor resistance
mmu01522  Endocrine resistance
mmu01524  Platinum drug resistance
mmu04012  ErbB signaling pathway
mmu04014  Ras signaling pathway
mmu04015  Rap1 signaling pathway
mmu04024  cAMP signaling pathway
mmu04062  Chemokine signaling pathway
mmu04066  HIF-1 signaling pathway
mmu04068  FoxO signaling pathway
mmu04070  Phosphatidylinositol signaling system
mmu04071  Sphingolipid signaling pathway
mmu04072  Phospholipase D signaling pathway
mmu04140  Autophagy - animal
mmu04150  mTOR signaling pathway
mmu04151  PI3K-Akt signaling pathway
mmu04152  AMPK signaling pathway
mmu04210  Apoptosis
mmu04211  Longevity regulating pathway
mmu04213  Longevity regulating pathway - multiple species
mmu04218  Cellular senescence
mmu04360  Axon guidance
mmu04370  VEGF signaling pathway
mmu04380  Osteoclast differentiation
mmu04510  Focal adhesion
mmu04550  Signaling pathways regulating pluripotency of stem cells
mmu04611  Platelet activation
mmu04613  Neutrophil extracellular trap formation
mmu04620  Toll-like receptor signaling pathway
mmu04625  C-type lectin receptor signaling pathway
mmu04630  JAK-STAT signaling pathway
mmu04650  Natural killer cell mediated cytotoxicity
mmu04660  T cell receptor signaling pathway
mmu04662  B cell receptor signaling pathway
mmu04664  Fc epsilon RI signaling pathway
mmu04666  Fc gamma R-mediated phagocytosis
mmu04668  TNF signaling pathway
mmu04670  Leukocyte transendothelial migration
mmu04722  Neurotrophin signaling pathway
mmu04725  Cholinergic synapse
mmu04750  Inflammatory mediator regulation of TRP channels
mmu04810  Regulation of actin cytoskeleton
mmu04910  Insulin signaling pathway
mmu04914  Progesterone-mediated oocyte maturation
mmu04915  Estrogen signaling pathway
mmu04917  Prolactin signaling pathway
mmu04919  Thyroid hormone signaling pathway
mmu04923  Regulation of lipolysis in adipocytes
mmu04926  Relaxin signaling pathway
mmu04929  GnRH secretion
mmu04930  Type II diabetes mellitus
mmu04931  Insulin resistance
mmu04932  Non-alcoholic fatty liver disease
mmu04933  AGE-RAGE signaling pathway in diabetic complications
mmu04935  Growth hormone synthesis, secretion and action
mmu04960  Aldosterone-regulated sodium reabsorption
mmu04973  Carbohydrate digestion and absorption
mmu05010  Alzheimer disease
mmu05017  Spinocerebellar ataxia
mmu05020  Prion disease
mmu05100  Bacterial invasion of epithelial cells
mmu05132  Salmonella infection
mmu05135  Yersinia infection
mmu05142  Chagas disease
mmu05146  Amoebiasis
mmu05160  Hepatitis C
mmu05161  Hepatitis B
mmu05162  Measles
mmu05163  Human cytomegalovirus infection
mmu05164  Influenza A
mmu05165  Human papillomavirus infection
mmu05166  Human T-cell leukemia virus 1 infection
mmu05167  Kaposi sarcoma-associated herpesvirus infection
mmu05168  Herpes simplex virus 1 infection
mmu05169  Epstein-Barr virus infection
mmu05170  Human immunodeficiency virus 1 infection
mmu05171  Coronavirus disease - COVID-19
mmu05200  Pathways in cancer
mmu05203  Viral carcinogenesis
mmu05205  Proteoglycans in cancer
mmu05206  MicroRNAs in cancer
mmu05210  Colorectal cancer
mmu05211  Renal cell carcinoma
mmu05212  Pancreatic cancer
mmu05213  Endometrial cancer
mmu05214  Glioma
mmu05215  Prostate cancer
mmu05218  Melanoma
mmu05220  Chronic myeloid leukemia
mmu05221  Acute myeloid leukemia
mmu05222  Small cell lung cancer
mmu05223  Non-small cell lung cancer
mmu05224  Breast cancer
mmu05225  Hepatocellular carcinoma
mmu05226  Gastric cancer
mmu05230  Central carbon metabolism in cancer
mmu05231  Choline metabolism in cancer
mmu05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
mmu05415  Diabetic cardiomyopathy
mmu05417  Lipid and atherosclerosis
mmu05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    74769 (Pik3cb)
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    74769 (Pik3cb)
   04014 Ras signaling pathway
    74769 (Pik3cb)
   04015 Rap1 signaling pathway
    74769 (Pik3cb)
   04370 VEGF signaling pathway
    74769 (Pik3cb)
   04630 JAK-STAT signaling pathway
    74769 (Pik3cb)
   04668 TNF signaling pathway
    74769 (Pik3cb)
   04066 HIF-1 signaling pathway
    74769 (Pik3cb)
   04068 FoxO signaling pathway
    74769 (Pik3cb)
   04070 Phosphatidylinositol signaling system
    74769 (Pik3cb)
   04072 Phospholipase D signaling pathway
    74769 (Pik3cb)
   04071 Sphingolipid signaling pathway
    74769 (Pik3cb)
   04024 cAMP signaling pathway
    74769 (Pik3cb)
   04151 PI3K-Akt signaling pathway
    74769 (Pik3cb)
   04152 AMPK signaling pathway
    74769 (Pik3cb)
   04150 mTOR signaling pathway
    74769 (Pik3cb)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    74769 (Pik3cb)
  09143 Cell growth and death
   04210 Apoptosis
    74769 (Pik3cb)
   04218 Cellular senescence
    74769 (Pik3cb)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    74769 (Pik3cb)
   04550 Signaling pathways regulating pluripotency of stem cells
    74769 (Pik3cb)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    74769 (Pik3cb)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    74769 (Pik3cb)
   04613 Neutrophil extracellular trap formation
    74769 (Pik3cb)
   04620 Toll-like receptor signaling pathway
    74769 (Pik3cb)
   04625 C-type lectin receptor signaling pathway
    74769 (Pik3cb)
   04650 Natural killer cell mediated cytotoxicity
    74769 (Pik3cb)
   04660 T cell receptor signaling pathway
    74769 (Pik3cb)
   04662 B cell receptor signaling pathway
    74769 (Pik3cb)
   04664 Fc epsilon RI signaling pathway
    74769 (Pik3cb)
   04666 Fc gamma R-mediated phagocytosis
    74769 (Pik3cb)
   04670 Leukocyte transendothelial migration
    74769 (Pik3cb)
   04062 Chemokine signaling pathway
    74769 (Pik3cb)
  09152 Endocrine system
   04910 Insulin signaling pathway
    74769 (Pik3cb)
   04923 Regulation of lipolysis in adipocytes
    74769 (Pik3cb)
   04929 GnRH secretion
    74769 (Pik3cb)
   04915 Estrogen signaling pathway
    74769 (Pik3cb)
   04914 Progesterone-mediated oocyte maturation
    74769 (Pik3cb)
   04917 Prolactin signaling pathway
    74769 (Pik3cb)
   04926 Relaxin signaling pathway
    74769 (Pik3cb)
   04935 Growth hormone synthesis, secretion and action
    74769 (Pik3cb)
   04919 Thyroid hormone signaling pathway
    74769 (Pik3cb)
  09154 Digestive system
   04973 Carbohydrate digestion and absorption
    74769 (Pik3cb)
  09155 Excretory system
   04960 Aldosterone-regulated sodium reabsorption
    74769 (Pik3cb)
  09156 Nervous system
   04725 Cholinergic synapse
    74769 (Pik3cb)
   04722 Neurotrophin signaling pathway
    74769 (Pik3cb)
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    74769 (Pik3cb)
  09158 Development and regeneration
   04360 Axon guidance
    74769 (Pik3cb)
   04380 Osteoclast differentiation
    74769 (Pik3cb)
  09149 Aging
   04211 Longevity regulating pathway
    74769 (Pik3cb)
   04213 Longevity regulating pathway - multiple species
    74769 (Pik3cb)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    74769 (Pik3cb)
   05206 MicroRNAs in cancer
    74769 (Pik3cb)
   05205 Proteoglycans in cancer
    74769 (Pik3cb)
   05203 Viral carcinogenesis
    74769 (Pik3cb)
   05230 Central carbon metabolism in cancer
    74769 (Pik3cb)
   05231 Choline metabolism in cancer
    74769 (Pik3cb)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    74769 (Pik3cb)
  09162 Cancer: specific types
   05210 Colorectal cancer
    74769 (Pik3cb)
   05212 Pancreatic cancer
    74769 (Pik3cb)
   05225 Hepatocellular carcinoma
    74769 (Pik3cb)
   05226 Gastric cancer
    74769 (Pik3cb)
   05214 Glioma
    74769 (Pik3cb)
   05221 Acute myeloid leukemia
    74769 (Pik3cb)
   05220 Chronic myeloid leukemia
    74769 (Pik3cb)
   05218 Melanoma
    74769 (Pik3cb)
   05211 Renal cell carcinoma
    74769 (Pik3cb)
   05215 Prostate cancer
    74769 (Pik3cb)
   05213 Endometrial cancer
    74769 (Pik3cb)
   05224 Breast cancer
    74769 (Pik3cb)
   05222 Small cell lung cancer
    74769 (Pik3cb)
   05223 Non-small cell lung cancer
    74769 (Pik3cb)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    74769 (Pik3cb)
   05170 Human immunodeficiency virus 1 infection
    74769 (Pik3cb)
   05161 Hepatitis B
    74769 (Pik3cb)
   05160 Hepatitis C
    74769 (Pik3cb)
   05171 Coronavirus disease - COVID-19
    74769 (Pik3cb)
   05164 Influenza A
    74769 (Pik3cb)
   05162 Measles
    74769 (Pik3cb)
   05168 Herpes simplex virus 1 infection
    74769 (Pik3cb)
   05163 Human cytomegalovirus infection
    74769 (Pik3cb)
   05167 Kaposi sarcoma-associated herpesvirus infection
    74769 (Pik3cb)
   05169 Epstein-Barr virus infection
    74769 (Pik3cb)
   05165 Human papillomavirus infection
    74769 (Pik3cb)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    74769 (Pik3cb)
   05135 Yersinia infection
    74769 (Pik3cb)
   05100 Bacterial invasion of epithelial cells
    74769 (Pik3cb)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    74769 (Pik3cb)
   05142 Chagas disease
    74769 (Pik3cb)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    74769 (Pik3cb)
   05017 Spinocerebellar ataxia
    74769 (Pik3cb)
   05020 Prion disease
    74769 (Pik3cb)
  09166 Cardiovascular disease
   05417 Lipid and atherosclerosis
    74769 (Pik3cb)
   05418 Fluid shear stress and atherosclerosis
    74769 (Pik3cb)
   05415 Diabetic cardiomyopathy
    74769 (Pik3cb)
  09167 Endocrine and metabolic disease
   04930 Type II diabetes mellitus
    74769 (Pik3cb)
   04932 Non-alcoholic fatty liver disease
    74769 (Pik3cb)
   04931 Insulin resistance
    74769 (Pik3cb)
   04933 AGE-RAGE signaling pathway in diabetic complications
    74769 (Pik3cb)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    74769 (Pik3cb)
   01524 Platinum drug resistance
    74769 (Pik3cb)
   01522 Endocrine resistance
    74769 (Pik3cb)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:mmu04131]
    74769 (Pik3cb)
Enzymes [BR:mmu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.153  phosphatidylinositol-4,5-bisphosphate 3-kinase
     74769 (Pik3cb)
Membrane trafficking [BR:mmu04131]
 Endocytosis
  Rab GTPases and associated proteins
   Rab associated proteins
    74769 (Pik3cb)
SSDB
Motif
Pfam: PI3Ka PI3_PI4_kinase PI3K_rbd PI3K_p85B PI3K_C2 Tom37_C
Other DBs
NCBI-GeneID: 74769
NCBI-ProteinID: NP_083370
MGI: 1922019
Ensembl: ENSMUSG00000032462
Vega: OTTMUSG00000021081
UniProt: Q8BTI9
Structure
PDB: 
4BFR 2Y3A

Position
9; 9 E3.3
AA seq 1064 aa
MPPAMADNLDIWAVDSQIASDGAISVDFLLPTGIYIQLEVPREATISYIKQMLWKQVHNY
PMFNLLMDIDSYMFACVNQTAVYEELEDETRRLCDVRPFLPVLKLVTRSCDPAEKLDSKI
GVLIGKGLHEFDALKDPEVNEFRRKMRKFSEAKIQSLVGLSWIDWLKHTYPPEHEPSVLE
NLEDKLYGGKLVVAVHFENSQDVFSFQVSPNLNPIKINELAIQKRLTIRGKEDEASPCDY
VLQVSGRVEYVFGDHPLIQFQYIRNCVMNRTLPHFILVECCKIKKMYEQEMIAIEAAINR
NSSNLPLPLPPKKTRVISHIWDNNNPFQITLVKGNKLNTEETVKVHVRAGLFHGTELLCK
TVVSSEISGKNDHIWNEQLEFDINICDLPRMARLCFAVYAVLDKVKTKKSTKTINPSKYQ
TIRKAGKVHYPVAWVNTMVFDFKGQLRSGDVILHSWSSFPDELEEMLNPMGTVQTNPYAE
NATALHITFPENKKQPCYYPPFDKIIEKAAELASGDSANVSSRGGKKFLAVLKEILDRDP
LSQLCENEMDLIWTLRQDCRENFPQSLPKLLLSIKWNKLEDVAQLQALLQIWPKLPPREA
LELLDFNYPDQYVREYAVGCLRQMSDEELSQYLLQLVQVLKYEPFLDCALSRFLLERALD
NRRIGQFLFWHLRSEVHTPAVSVQFGVILEAYCRGSVGHMKVLSKQVEALNKLKTLNSLI
KLNAVKLSRAKGKEAMHTCLKQSAYREALSDLQSPLNPCVILSELYVEKCKYMDSKMKPL
WLVYSSRAFGEDSVGVIFKNGDDLRQDMLTLQMLRLMDLLWKEAGLDLRMLPYGCLATGD
RSGLIEVVSTSETIADIQLNSSNVAATAAFNKDALLNWLKEYNSGDDLDRAIEEFTLSCA
GYCVASYVLGIGDRHSDNIMVKKTGQLFHIDFGHILGNFKSKFGIKRERVPFILTYDFIH
VIQQGKTGNTEKFGRFRQCCEDAYLILRRHGNLFITLFALMLTAGLPELTSVKDIQYLKD
SLALGKSEEEALKQFKQKFDEALRESWTTKVNWMAHTVRKDYRS
NT seq 3195 nt   +upstreamnt  +downstreamnt
atgcctcctgctatggcagacaaccttgacatctgggcagtggactcacagattgcatcc
gatggcgccatatccgtcgatttccttctgcccaccgggatttatatccagttggaagta
cctcgggaagctaccatttcttatattaaacagatgttatggaagcaagttcacaactac
ccgatgtttaacctcctcatggacattgactcgtatatgtttgcatgtgtgaatcaaact
gctgtatatgaggaactggaagacgaaacacgaagactttgtgatgtcagaccttttctt
ccagttctcaaactagtgactagaagctgtgaccccgcagaaaaattggactcaaaaatt
ggggttcttataggaaaaggtcttcatgagtttgatgccttgaaggatcccgaagtgaat
gaatttagaagaaaaatgcgcaaattcagtgaggccaagattcagtctctggtagggttg
tcttggatcgactggctaaagcacacgtatccgcctgagcacgagccgtccgtcctggag
aacttggaagataaactttatggaggaaagctggttgtggctgtgcactttgaaaatagc
caggatgtatttagttttcaagtgtctcccaatttgaatcctataaaaataaatgaattg
gcaatccagaaacgcctcactattcgtggaaaggaagatgaagctagcccctgtgactat
gtgttacaggtcagtgggagagtggagtatgtgtttggcgatcatccactaattcagttc
cagtacatccggaattgtgtgatgaatagaaccctgccccacttcatccttgtggaatgt
tgtaagatcaagaaaatgtatgaacaagaaatgattgccatagaggctgccatcaaccga
aactcatccaaccttcctctccctttaccaccaaagaaaacgcgagttatttctcatatc
tgggacaacaacaaccctttccaaattaccttggttaaaggaaataagcttaatacagaa
gaaactgtgaaagttcatgtccgagctgggctttttcacggaaccgagctcctgtgtaaa
accgtcgtaagctcagagatatcaggaaagaacgaccatatttggaatgaacaactggaa
tttgatattaatatttgtgacttaccaagaatggctcgattatgttttgctgtttatgca
gttttggataaagtaaaaacgaagaaatcaacaaagactattaatccctctaagtatcag
accatcaggaaagccgggaaagtgcattatcctgtcgcatgggtaaataccatggttttt
gacttcaaaggacagctgaggtctggagacgtcatattgcatagctggtcttcgtttcct
gatgagctggaagaaatgctgaatcccatggggactgtgcagacgaacccatatgctgag
aacgccaccgccttgcacattacgttcccagagaataagaagcagccgtgttattatccc
cccttcgataagatcattgagaaggcagctgagcttgccagcggagacagtgctaatgtg
tcaagtcgtggtggaaaaaaatttcttgctgtgctgaaagaaatcttggacagggacccc
ctgtctcagctgtgtgagaacgaaatggaccttatttggactctacggcaagactgccga
gaaaatttccctcagtcactgccaaaactactcttgtcaatcaagtggaataaacttgaa
gatgttgctcagcttcaggcgctcctgcagatatggcccaaactgccccccagggaagcc
ctggaactcctggatttcaactatccagaccagtatgtccgggaatacgctgtaggctgc
cttcgacagatgagtgatgaagaactctctcagtatcttttacaattggtgcaagttttg
aaatatgagccttttctcgattgtgccctctccagattcctattagaaagagcacttgat
aatcggaggattgggcagtttctgttttggcatcttaggtcagaggtgcacactcctgct
gtgtccgtacagtttggtgtcatcctggaagcatactgtcgaggaagcgtggggcacatg
aaagtgctttccaaacaggtggaagcactcaataagttaaaaactttaaatagcttaatc
aaactgaatgcggtgaagctgagcagagctaagggaaaggaggccatgcacacgtgcctg
aaacagagtgcttaccgggaggcgctctctgacctgcagtcgccgctgaacccctgcgtc
atcctctcagagctctatgttgaaaagtgcaaatacatggactccaagatgaagcccctg
tggctggtctacagcagcagagcctttggagaggactcggttggagtgatctttaaaaat
ggtgacgatttgcggcaggacatgctgacgctgcagatgttgcgcctgatggatctgctt
tggaaagaagctggcttggacctgcggatgctcccctatggctgcttagcaacaggagat
cgctctggcctcattgaggttgtgagcacctctgagacaatcgctgacattcagctgaac
agtagtaacgtggctgccacggcagccttcaacaaagacgcactcctgaactggctcaag
gagtacaactctggggatgacctggaccgagcgattgaggagtttaccttgtcctgtgct
ggctactgtgtagcctcttatgtcctcggcattggtgacaggcacagtgacaacatcatg
gtgaagaaaaccggccagctcttccacatagattttgggcatattcttggaaatttcaaa
tctaaatttggcattaaaagggagcgagtaccttttattcttacttatgacttcattcat
gtcattcaacaaggaaaaacgggaaacactgaaaaatttggcagattccgccagtgctgt
gaagatgcgtatctgattttacggcggcatgggaatctcttcatcaccctgtttgccctg
atgttgactgcagggctgcctgagctcacatcggtcaaagatatacagtatcttaaggac
tcgcttgccttagggaagagcgaggaggaagcactgaagcagttcaagcagaagtttgac
gaggccctcagggaaagctggactactaaagtgaactggatggctcacacagtacggaaa
gactacaggtcctag

DBGET integrated database retrieval system