KEGG   Mus musculus (mouse): 18707Help
Entry
18707             CDS       T01002                                 

Gene name
Pik3cd, 2410099E07Rik, 2610208K16Rik, AW545373, p110delta
Definition
(RefSeq) phosphatidylinositol-4,5-bisphosphate 3-kinase catalytic subunit delta
  KO
K00922  phosphatidylinositol-4,5-bisphosphate 3-kinase catalytic subunit alpha/beta/delta [EC:2.7.1.153]
Organism
mmu  Mus musculus (mouse)
Pathway
mmu00562  Inositol phosphate metabolism
mmu01521  EGFR tyrosine kinase inhibitor resistance
mmu01522  Endocrine resistance
mmu01524  Platinum drug resistance
mmu04012  ErbB signaling pathway
mmu04014  Ras signaling pathway
mmu04015  Rap1 signaling pathway
mmu04024  cAMP signaling pathway
mmu04062  Chemokine signaling pathway
mmu04066  HIF-1 signaling pathway
mmu04068  FoxO signaling pathway
mmu04070  Phosphatidylinositol signaling system
mmu04071  Sphingolipid signaling pathway
mmu04072  Phospholipase D signaling pathway
mmu04140  Autophagy - animal
mmu04150  mTOR signaling pathway
mmu04151  PI3K-Akt signaling pathway
mmu04152  AMPK signaling pathway
mmu04210  Apoptosis
mmu04211  Longevity regulating pathway
mmu04213  Longevity regulating pathway - multiple species
mmu04218  Cellular senescence
mmu04360  Axon guidance
mmu04370  VEGF signaling pathway
mmu04380  Osteoclast differentiation
mmu04510  Focal adhesion
mmu04550  Signaling pathways regulating pluripotency of stem cells
mmu04611  Platelet activation
mmu04620  Toll-like receptor signaling pathway
mmu04625  C-type lectin receptor signaling pathway
mmu04630  Jak-STAT signaling pathway
mmu04650  Natural killer cell mediated cytotoxicity
mmu04660  T cell receptor signaling pathway
mmu04662  B cell receptor signaling pathway
mmu04664  Fc epsilon RI signaling pathway
mmu04666  Fc gamma R-mediated phagocytosis
mmu04668  TNF signaling pathway
mmu04670  Leukocyte transendothelial migration
mmu04722  Neurotrophin signaling pathway
mmu04725  Cholinergic synapse
mmu04750  Inflammatory mediator regulation of TRP channels
mmu04810  Regulation of actin cytoskeleton
mmu04910  Insulin signaling pathway
mmu04914  Progesterone-mediated oocyte maturation
mmu04915  Estrogen signaling pathway
mmu04917  Prolactin signaling pathway
mmu04919  Thyroid hormone signaling pathway
mmu04923  Regulation of lipolysis in adipocytes
mmu04926  Relaxin signaling pathway
mmu04930  Type II diabetes mellitus
mmu04931  Insulin resistance
mmu04932  Non-alcoholic fatty liver disease (NAFLD)
mmu04933  AGE-RAGE signaling pathway in diabetic complications
mmu04960  Aldosterone-regulated sodium reabsorption
mmu04973  Carbohydrate digestion and absorption
mmu05100  Bacterial invasion of epithelial cells
mmu05142  Chagas disease (American trypanosomiasis)
mmu05146  Amoebiasis
mmu05160  Hepatitis C
mmu05161  Hepatitis B
mmu05162  Measles
mmu05164  Influenza A
mmu05165  Human papillomavirus infection
mmu05166  HTLV-I infection
mmu05167  Kaposi's sarcoma-associated herpesvirus infection
mmu05169  Epstein-Barr virus infection
mmu05200  Pathways in cancer
mmu05203  Viral carcinogenesis
mmu05205  Proteoglycans in cancer
mmu05210  Colorectal cancer
mmu05211  Renal cell carcinoma
mmu05212  Pancreatic cancer
mmu05213  Endometrial cancer
mmu05214  Glioma
mmu05215  Prostate cancer
mmu05218  Melanoma
mmu05220  Chronic myeloid leukemia
mmu05221  Acute myeloid leukemia
mmu05222  Small cell lung cancer
mmu05223  Non-small cell lung cancer
mmu05224  Breast cancer
mmu05225  Hepatocellular carcinoma
mmu05226  Gastric cancer
mmu05230  Central carbon metabolism in cancer
mmu05231  Choline metabolism in cancer
mmu05418  Fluid shear stress and atherosclerosis
Module
mmu_M00676  PI3K-Akt signaling
Brite
KEGG Orthology (KO) [BR:mmu00001]
 Metabolism
  Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    18707 (Pik3cd)
 Environmental Information Processing
  Signal transduction
   04014 Ras signaling pathway
    18707 (Pik3cd)
   04015 Rap1 signaling pathway
    18707 (Pik3cd)
   04012 ErbB signaling pathway
    18707 (Pik3cd)
   04370 VEGF signaling pathway
    18707 (Pik3cd)
   04630 Jak-STAT signaling pathway
    18707 (Pik3cd)
   04668 TNF signaling pathway
    18707 (Pik3cd)
   04066 HIF-1 signaling pathway
    18707 (Pik3cd)
   04068 FoxO signaling pathway
    18707 (Pik3cd)
   04070 Phosphatidylinositol signaling system
    18707 (Pik3cd)
   04072 Phospholipase D signaling pathway
    18707 (Pik3cd)
   04071 Sphingolipid signaling pathway
    18707 (Pik3cd)
   04024 cAMP signaling pathway
    18707 (Pik3cd)
   04151 PI3K-Akt signaling pathway
    18707 (Pik3cd)
   04152 AMPK signaling pathway
    18707 (Pik3cd)
   04150 mTOR signaling pathway
    18707 (Pik3cd)
 Cellular Processes
  Transport and catabolism
   04140 Autophagy - animal
    18707 (Pik3cd)
  Cell growth and death
   04210 Apoptosis
    18707 (Pik3cd)
   04218 Cellular senescence
    18707 (Pik3cd)
  Cellular community - eukaryotes
   04510 Focal adhesion
    18707 (Pik3cd)
   04550 Signaling pathways regulating pluripotency of stem cells
    18707 (Pik3cd)
  Cell motility
   04810 Regulation of actin cytoskeleton
    18707 (Pik3cd)
 Organismal Systems
  Immune system
   04611 Platelet activation
    18707 (Pik3cd)
   04620 Toll-like receptor signaling pathway
    18707 (Pik3cd)
   04625 C-type lectin receptor signaling pathway
    18707 (Pik3cd)
   04650 Natural killer cell mediated cytotoxicity
    18707 (Pik3cd)
   04660 T cell receptor signaling pathway
    18707 (Pik3cd)
   04662 B cell receptor signaling pathway
    18707 (Pik3cd)
   04664 Fc epsilon RI signaling pathway
    18707 (Pik3cd)
   04666 Fc gamma R-mediated phagocytosis
    18707 (Pik3cd)
   04670 Leukocyte transendothelial migration
    18707 (Pik3cd)
   04062 Chemokine signaling pathway
    18707 (Pik3cd)
  Endocrine system
   04910 Insulin signaling pathway
    18707 (Pik3cd)
   04923 Regulation of lipolysis in adipocyte
    18707 (Pik3cd)
   04915 Estrogen signaling pathway
    18707 (Pik3cd)
   04914 Progesterone-mediated oocyte maturation
    18707 (Pik3cd)
   04917 Prolactin signaling pathway
    18707 (Pik3cd)
   04926 Relaxin signaling pathway
    18707 (Pik3cd)
   04919 Thyroid hormone signaling pathway
    18707 (Pik3cd)
  Digestive system
   04973 Carbohydrate digestion and absorption
    18707 (Pik3cd)
  Excretory system
   04960 Aldosterone-regulated sodium reabsorption
    18707 (Pik3cd)
  Nervous system
   04725 Cholinergic synapse
    18707 (Pik3cd)
   04722 Neurotrophin signaling pathway
    18707 (Pik3cd)
  Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    18707 (Pik3cd)
  Development
   04360 Axon guidance
    18707 (Pik3cd)
   04380 Osteoclast differentiation
    18707 (Pik3cd)
  Aging
   04211 Longevity regulating pathway - mammal
    18707 (Pik3cd)
   04213 Longevity regulating pathway - multiple species
    18707 (Pik3cd)
 Human Diseases
  Cancers
   05200 Pathways in cancer
    18707 (Pik3cd)
   05230 Central carbon metabolism in cancer
    18707 (Pik3cd)
   05231 Choline metabolism in cancer
    18707 (Pik3cd)
   05205 Proteoglycans in cancer
    18707 (Pik3cd)
   05203 Viral carcinogenesis
    18707 (Pik3cd)
   05210 Colorectal cancer
    18707 (Pik3cd)
   05212 Pancreatic cancer
    18707 (Pik3cd)
   05225 Hepatocellular carcinoma
    18707 (Pik3cd)
   05226 Gastric cancer
    18707 (Pik3cd)
   05214 Glioma
    18707 (Pik3cd)
   05221 Acute myeloid leukemia
    18707 (Pik3cd)
   05220 Chronic myeloid leukemia
    18707 (Pik3cd)
   05218 Melanoma
    18707 (Pik3cd)
   05211 Renal cell carcinoma
    18707 (Pik3cd)
   05215 Prostate cancer
    18707 (Pik3cd)
   05213 Endometrial cancer
    18707 (Pik3cd)
   05224 Breast cancer
    18707 (Pik3cd)
   05222 Small cell lung cancer
    18707 (Pik3cd)
   05223 Non-small cell lung cancer
    18707 (Pik3cd)
  Cardiovascular diseases
   05418 Fluid shear stress and atherosclerosis
    18707 (Pik3cd)
  Endocrine and metabolic diseases
   04930 Type II diabetes mellitus
    18707 (Pik3cd)
   04932 Non-alcoholic fatty liver disease (NAFLD)
    18707 (Pik3cd)
   04931 Insulin resistance
    18707 (Pik3cd)
   04933 AGE-RAGE signaling pathway in diabetic complications
    18707 (Pik3cd)
  Infectious diseases
   05100 Bacterial invasion of epithelial cells
    18707 (Pik3cd)
   05166 HTLV-I infection
    18707 (Pik3cd)
   05162 Measles
    18707 (Pik3cd)
   05164 Influenza A
    18707 (Pik3cd)
   05161 Hepatitis B
    18707 (Pik3cd)
   05160 Hepatitis C
    18707 (Pik3cd)
   05167 Kaposi's sarcoma-associated herpesvirus infection
    18707 (Pik3cd)
   05169 Epstein-Barr virus infection
    18707 (Pik3cd)
   05165 Human papillomavirus infection
    18707 (Pik3cd)
   05146 Amoebiasis
    18707 (Pik3cd)
   05142 Chagas disease (American trypanosomiasis)
    18707 (Pik3cd)
  Drug resistance
   01521 EGFR tyrosine kinase inhibitor resistance
    18707 (Pik3cd)
   01524 Platinum drug resistance
    18707 (Pik3cd)
   01522 Endocrine resistance
    18707 (Pik3cd)
Enzymes [BR:mmu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.153  phosphatidylinositol-4,5-bisphosphate 3-kinase
     18707 (Pik3cd)
Membrane trafficking [BR:mmu04131]
 Endocytosis
  Rab GTPases and associated proteins
   Rab associated proteins
    18707 (Pik3cd)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PI3_PI4_kinase PI3Ka PI3K_p85B PI3K_rbd PI3K_C2 DUF4135
Motif
Other DBs
NCBI-GeneID: 18707
NCBI-ProteinID: NP_001157524
MGI: 1098211
Ensembl: ENSMUSG00000039936
Vega: OTTMUSG00000010264
UniProt: O35904
Structure
PDB: 

Position
4; 4 E2
AA seq 1043 aa AA seqDB search
MPPGVDCPMEFWTKEESQSVVVDFLLPTGVYLNFPVSRNANLSTIKQVLWHRAQYEPLFH
MLSDPEAYVFTCVNQTAEQQELEDEQRRLCDIQPFLPVLRLVAREGDRVKKLINSQISLL
IGKGLHEFDSLRDPEVNDFRTKMRQFCEEAAAHRQQLGWVEWLQYSFPLQLEPSARGWRA
GLLRVSNRALLVNVKFEGSEESFTFQVSTKDMPLALMACALRKKATVFRQPLVEQPEEYA
LQVNGRHEYLYGNYPLCHFQYICSCLHSGLTPHLTMVHSSSILAMRDEQSNPAPQVQKPR
AKPPPIPAKKPSSVSLWSLEQPFSIELIEGRKVNADERMKLVVQAGLFHGNEMLCKTVSS
SEVNVCSEPVWKQRLEFDISVCDLPRMARLCFALYAVVEKAKKARSTKKKSKKADCPIAW
ANLMLFDYKDQLKTGERCLYMWPSVPDEKGELLNPAGTVRGNPNTESAAALVIYLPEVAP
HPVYFPALEKILELGRHGERGRITEEELQLREILERRGSGELYEHEKDLVWKMRHEVQEH
FPEALARLLLVTKWNKHEDVAQMLYLLCSWPELPVLSALELLDFSFPDCYVGSFAIKSLR
KLTDDELFQYLLQLVQVLKYESYLDCELTKFLLGRALANRKIGHFLFWHLRSEMHVPSVA
LRFGLIMEAYCRGSTHHMKVLMKQGEALSKLKALNDFVKVSSQKTTKPQTKEMMHMCMRQ
ETYMEALSHLQSPLDPSTLLEEVCVEQCTFMDSKMKPLWIMYSSEEAGSAGNVGIIFKNG
DDLRQDMLTLQMIQLMDVLWKQEGLDLRMTPYGCLPTGDRTGLIEVVLHSDTIANIQLNK
SNMAATAAFNKDALLNWLKSKNPGEALDRAIEEFTLSCAGYCVATYVLGIGDRHSDNIMI
RESGQLFHIDFGHFLGNFKTKFGINRERVPFILTYDFVHVIQQGKTNNSEKFERFRGYCE
RAYTILRRHGLLFLHLFALMRAAGLPELSCSKDIQYLKDSLALGKTEEEALKHFRVKFNE
ALRESWKTKVNWLAHNVSKDNRQ
NT seq 3132 nt NT seq  +upstreamnt  +downstreamnt
atgccccctggggtggactgccccatggagttctggaccaaagaggagagccagagcgtg
gttgttgacttcttgctgcccacaggggtctacttgaacttccccgtgtcccgcaatgcc
aacctcagcaccatcaagcaggtgctgtggcaccgtgcacagtatgagccactcttccac
atgctcagtgaccccgaggcctatgtgttcacctgtgtgaaccagacggcggagcagcag
gagttggaggatgagcagcggaggctgtgcgacatccagcccttcctgcccgtgctgcgc
ctcgtggcccgagagggggaccgcgtgaagaagctcattaactcccagatcagcctcctc
attggcaaaggtctccatgagtttgattccctgcgggacccggaagtaaacgacttccgc
actaagatgcgccagttttgtgaagaggctgctgctcaccgccagcagctgggctgggtg
gaatggctgcagtacagcttccccctgcagctggagccctcagcaaggggttggcgggcc
ggcttattgcgtgtcagcaaccgagccctgctggtcaacgtgaagttcgagggcagtgag
gagagcttcaccttccaggtatccaccaaggacatgcccctggcactgatggcctgtgcc
ctccgaaaaaaggccacagtgttccggcagcctctggtggagcagcctgaggaatatgcc
ctgcaggtgaacgggaggcacgaatacctctacggcaactacccgctctgccactttcag
tacatctgcagctgcctacacagcgggctgacccctcatctgaccatggtccactcctcc
tccatccttgctatgcgggatgagcagagcaatcctgccccccaagtacagaaaccacgt
gccaaacctcccccgatccctgccaagaagccctcctctgtgtccctgtggtccctggaa
cagccattctccattgagctgatcgagggccgaaaagtgaatgctgacgagcggatgaag
ctggttgttcaggccgggctcttccatggcaatgagatgctgtgcaagactgtgtcaagc
tcggaggtgaatgtatgctcagagcccgtgtggaagcagcgactggagttcgatatcagc
gtctgtgacctcccgcgcatggctcgactctgttttgctctctatgccgtcgtggagaag
gctaagaaggcacgctccacaaagaagaagtctaagaaggcggactgccccatcgcttgg
gccaacctcatgctattcgactacaaagatcagctcaagacgggggagcgctgcctctac
atgtggccctctgtcccagatgagaagggagagctgctgaatcctgcgggtacagtgcgc
gggaaccccaacacggagagtgccgctgccctggtcatctacctgcctgaggtggccccc
caccctgtgtacttccccgctctggagaagatcctggagctggggcgtcacggggagcgt
gggcgcatcacggaggaggagctgcagctgcgggagatcctggaacggcggggatccggg
gaactgtacgaacatgagaaggacctggtgtggaagatgcgccacgaagtccaggagcat
ttcccagaggcgctggcccgcctgctgctggtcaccaagtggaataaacacgaggatgtg
gcccagatgctctatttgctgtgctcctggcccgagctgcctgtgctgagcgccctggaa
cttctggactttagctttcccgactgctacgtgggctccttcgccatcaagtcccttcgg
aagctgacggacgatgagctcttccagtaccttctgcagctggtgcaagtgctcaaatat
gagtcctacctggactgcgagctgaccaaattcttgctgggccgagccctggctaaccgc
aagatcggacacttcctgttctggcacctccgctctgagatgcacgtaccatcagtggct
ctgcggtttggtctcatcatggaagcctactgcagaggcagcacccaccacatgaaggtg
ctgatgaagcagggggaagcactgagcaagcttaaggcactgaatgactttgtgaaggtg
agttcccagaagaccaccaagccccaaaccaaggagatgatgcatatgtgcatgcgccag
gagacctacatggaggccctgtcccacctgcagtctccactcgaccccagcaccctgctg
gaggaagtctgtgtggagcagtgcaccttcatggactccaaaatgaagcccctgtggatc
atgtacagcagcgaggaggcgggcagtgctggcaacgtgggcatcatctttaagaacggg
gatgacctccgccaggacatgctgactctgcagatgatccagctcatggacgtcctgtgg
aagcaggagggcctggacctgaggatgacgccctacggctgcctccccaccggggaccgc
acaggtctcatcgaggtggtcctccactcggacaccatcgccaacatccagctgaacaaa
agcaacatggcggccacagctgccttcaacaaggacgccctgctcaactggctcaagtcc
aagaaccctggggaggccctggatcgggccattgaggaattcaccctctcctgtgctggc
tactgtgtggccacatatgttctgggcatcggtgaccggcacagcgacaacatcatgatc
agagagagtgggcagctcttccacattgattttggccactttctggggaacttcaagacc
aagtttggaatcaaccgagagcgcgtccccttcattctcacctacgactttgtccacgtg
atccagcaggggaagactaacaacagtgagaagtttgaaaggttccgcggctactgtgaa
cgagcctataccatcctgcggcgccacgggctgcttttcctccatctcttcgccctgatg
cgggccgcaggtctgcctgagcttagctgctccaaagatatccagtatctcaaggactct
ctggcactggggaagacggaggaagaggcgctaaagcacttccgggtgaagttcaacgaa
gctctccgagaaagctggaaaaccaaagtcaactggctggcgcacaatgtgtccaaggat
aaccgacagtag

DBGET integrated database retrieval system