KEGG   Mus musculus (house mouse): 18710
Entry
18710             CDS       T01002                                 
Symbol
Pik3r3, AA414954, p55, p55pik
Name
(RefSeq) phosphoinositide-3-kinase regulatory subunit 3
  KO
K02649  phosphoinositide-3-kinase regulatory subunit alpha/beta/delta
Organism
mmu  Mus musculus (house mouse)
Pathway
mmu01521  EGFR tyrosine kinase inhibitor resistance
mmu01522  Endocrine resistance
mmu01524  Platinum drug resistance
mmu04012  ErbB signaling pathway
mmu04014  Ras signaling pathway
mmu04015  Rap1 signaling pathway
mmu04024  cAMP signaling pathway
mmu04062  Chemokine signaling pathway
mmu04066  HIF-1 signaling pathway
mmu04068  FoxO signaling pathway
mmu04070  Phosphatidylinositol signaling system
mmu04071  Sphingolipid signaling pathway
mmu04072  Phospholipase D signaling pathway
mmu04140  Autophagy - animal
mmu04150  mTOR signaling pathway
mmu04151  PI3K-Akt signaling pathway
mmu04152  AMPK signaling pathway
mmu04210  Apoptosis
mmu04211  Longevity regulating pathway
mmu04213  Longevity regulating pathway - multiple species
mmu04218  Cellular senescence
mmu04360  Axon guidance
mmu04370  VEGF signaling pathway
mmu04380  Osteoclast differentiation
mmu04510  Focal adhesion
mmu04550  Signaling pathways regulating pluripotency of stem cells
mmu04611  Platelet activation
mmu04613  Neutrophil extracellular trap formation
mmu04620  Toll-like receptor signaling pathway
mmu04625  C-type lectin receptor signaling pathway
mmu04630  JAK-STAT signaling pathway
mmu04650  Natural killer cell mediated cytotoxicity
mmu04660  T cell receptor signaling pathway
mmu04662  B cell receptor signaling pathway
mmu04664  Fc epsilon RI signaling pathway
mmu04666  Fc gamma R-mediated phagocytosis
mmu04668  TNF signaling pathway
mmu04670  Leukocyte transendothelial migration
mmu04722  Neurotrophin signaling pathway
mmu04725  Cholinergic synapse
mmu04750  Inflammatory mediator regulation of TRP channels
mmu04810  Regulation of actin cytoskeleton
mmu04910  Insulin signaling pathway
mmu04914  Progesterone-mediated oocyte maturation
mmu04915  Estrogen signaling pathway
mmu04917  Prolactin signaling pathway
mmu04919  Thyroid hormone signaling pathway
mmu04923  Regulation of lipolysis in adipocytes
mmu04926  Relaxin signaling pathway
mmu04929  GnRH secretion
mmu04930  Type II diabetes mellitus
mmu04931  Insulin resistance
mmu04932  Non-alcoholic fatty liver disease
mmu04933  AGE-RAGE signaling pathway in diabetic complications
mmu04935  Growth hormone synthesis, secretion and action
mmu04960  Aldosterone-regulated sodium reabsorption
mmu04973  Carbohydrate digestion and absorption
mmu05010  Alzheimer disease
mmu05017  Spinocerebellar ataxia
mmu05020  Prion disease
mmu05100  Bacterial invasion of epithelial cells
mmu05135  Yersinia infection
mmu05142  Chagas disease
mmu05146  Amoebiasis
mmu05160  Hepatitis C
mmu05161  Hepatitis B
mmu05162  Measles
mmu05163  Human cytomegalovirus infection
mmu05164  Influenza A
mmu05165  Human papillomavirus infection
mmu05166  Human T-cell leukemia virus 1 infection
mmu05167  Kaposi sarcoma-associated herpesvirus infection
mmu05168  Herpes simplex virus 1 infection
mmu05169  Epstein-Barr virus infection
mmu05170  Human immunodeficiency virus 1 infection
mmu05171  Coronavirus disease - COVID-19
mmu05200  Pathways in cancer
mmu05203  Viral carcinogenesis
mmu05205  Proteoglycans in cancer
mmu05206  MicroRNAs in cancer
mmu05207  Chemical carcinogenesis - receptor activation
mmu05208  Chemical carcinogenesis - reactive oxygen species
mmu05210  Colorectal cancer
mmu05211  Renal cell carcinoma
mmu05212  Pancreatic cancer
mmu05213  Endometrial cancer
mmu05214  Glioma
mmu05215  Prostate cancer
mmu05218  Melanoma
mmu05220  Chronic myeloid leukemia
mmu05221  Acute myeloid leukemia
mmu05222  Small cell lung cancer
mmu05223  Non-small cell lung cancer
mmu05224  Breast cancer
mmu05225  Hepatocellular carcinoma
mmu05226  Gastric cancer
mmu05230  Central carbon metabolism in cancer
mmu05231  Choline metabolism in cancer
mmu05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
mmu05415  Diabetic cardiomyopathy
mmu05417  Lipid and atherosclerosis
mmu05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    18710 (Pik3r3)
   04014 Ras signaling pathway
    18710 (Pik3r3)
   04015 Rap1 signaling pathway
    18710 (Pik3r3)
   04370 VEGF signaling pathway
    18710 (Pik3r3)
   04630 JAK-STAT signaling pathway
    18710 (Pik3r3)
   04668 TNF signaling pathway
    18710 (Pik3r3)
   04066 HIF-1 signaling pathway
    18710 (Pik3r3)
   04068 FoxO signaling pathway
    18710 (Pik3r3)
   04070 Phosphatidylinositol signaling system
    18710 (Pik3r3)
   04072 Phospholipase D signaling pathway
    18710 (Pik3r3)
   04071 Sphingolipid signaling pathway
    18710 (Pik3r3)
   04024 cAMP signaling pathway
    18710 (Pik3r3)
   04151 PI3K-Akt signaling pathway
    18710 (Pik3r3)
   04152 AMPK signaling pathway
    18710 (Pik3r3)
   04150 mTOR signaling pathway
    18710 (Pik3r3)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    18710 (Pik3r3)
  09143 Cell growth and death
   04210 Apoptosis
    18710 (Pik3r3)
   04218 Cellular senescence
    18710 (Pik3r3)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    18710 (Pik3r3)
   04550 Signaling pathways regulating pluripotency of stem cells
    18710 (Pik3r3)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    18710 (Pik3r3)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    18710 (Pik3r3)
   04613 Neutrophil extracellular trap formation
    18710 (Pik3r3)
   04620 Toll-like receptor signaling pathway
    18710 (Pik3r3)
   04625 C-type lectin receptor signaling pathway
    18710 (Pik3r3)
   04650 Natural killer cell mediated cytotoxicity
    18710 (Pik3r3)
   04660 T cell receptor signaling pathway
    18710 (Pik3r3)
   04662 B cell receptor signaling pathway
    18710 (Pik3r3)
   04664 Fc epsilon RI signaling pathway
    18710 (Pik3r3)
   04666 Fc gamma R-mediated phagocytosis
    18710 (Pik3r3)
   04670 Leukocyte transendothelial migration
    18710 (Pik3r3)
   04062 Chemokine signaling pathway
    18710 (Pik3r3)
  09152 Endocrine system
   04910 Insulin signaling pathway
    18710 (Pik3r3)
   04923 Regulation of lipolysis in adipocytes
    18710 (Pik3r3)
   04929 GnRH secretion
    18710 (Pik3r3)
   04915 Estrogen signaling pathway
    18710 (Pik3r3)
   04914 Progesterone-mediated oocyte maturation
    18710 (Pik3r3)
   04917 Prolactin signaling pathway
    18710 (Pik3r3)
   04926 Relaxin signaling pathway
    18710 (Pik3r3)
   04935 Growth hormone synthesis, secretion and action
    18710 (Pik3r3)
   04919 Thyroid hormone signaling pathway
    18710 (Pik3r3)
  09154 Digestive system
   04973 Carbohydrate digestion and absorption
    18710 (Pik3r3)
  09155 Excretory system
   04960 Aldosterone-regulated sodium reabsorption
    18710 (Pik3r3)
  09156 Nervous system
   04725 Cholinergic synapse
    18710 (Pik3r3)
   04722 Neurotrophin signaling pathway
    18710 (Pik3r3)
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    18710 (Pik3r3)
  09158 Development and regeneration
   04360 Axon guidance
    18710 (Pik3r3)
   04380 Osteoclast differentiation
    18710 (Pik3r3)
  09149 Aging
   04211 Longevity regulating pathway
    18710 (Pik3r3)
   04213 Longevity regulating pathway - multiple species
    18710 (Pik3r3)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    18710 (Pik3r3)
   05206 MicroRNAs in cancer
    18710 (Pik3r3)
   05205 Proteoglycans in cancer
    18710 (Pik3r3)
   05207 Chemical carcinogenesis - receptor activation
    18710 (Pik3r3)
   05208 Chemical carcinogenesis - reactive oxygen species
    18710 (Pik3r3)
   05203 Viral carcinogenesis
    18710 (Pik3r3)
   05230 Central carbon metabolism in cancer
    18710 (Pik3r3)
   05231 Choline metabolism in cancer
    18710 (Pik3r3)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    18710 (Pik3r3)
  09162 Cancer: specific types
   05210 Colorectal cancer
    18710 (Pik3r3)
   05212 Pancreatic cancer
    18710 (Pik3r3)
   05225 Hepatocellular carcinoma
    18710 (Pik3r3)
   05226 Gastric cancer
    18710 (Pik3r3)
   05214 Glioma
    18710 (Pik3r3)
   05221 Acute myeloid leukemia
    18710 (Pik3r3)
   05220 Chronic myeloid leukemia
    18710 (Pik3r3)
   05218 Melanoma
    18710 (Pik3r3)
   05211 Renal cell carcinoma
    18710 (Pik3r3)
   05215 Prostate cancer
    18710 (Pik3r3)
   05213 Endometrial cancer
    18710 (Pik3r3)
   05224 Breast cancer
    18710 (Pik3r3)
   05222 Small cell lung cancer
    18710 (Pik3r3)
   05223 Non-small cell lung cancer
    18710 (Pik3r3)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    18710 (Pik3r3)
   05170 Human immunodeficiency virus 1 infection
    18710 (Pik3r3)
   05161 Hepatitis B
    18710 (Pik3r3)
   05160 Hepatitis C
    18710 (Pik3r3)
   05171 Coronavirus disease - COVID-19
    18710 (Pik3r3)
   05164 Influenza A
    18710 (Pik3r3)
   05162 Measles
    18710 (Pik3r3)
   05168 Herpes simplex virus 1 infection
    18710 (Pik3r3)
   05163 Human cytomegalovirus infection
    18710 (Pik3r3)
   05167 Kaposi sarcoma-associated herpesvirus infection
    18710 (Pik3r3)
   05169 Epstein-Barr virus infection
    18710 (Pik3r3)
   05165 Human papillomavirus infection
    18710 (Pik3r3)
  09171 Infectious disease: bacterial
   05135 Yersinia infection
    18710 (Pik3r3)
   05100 Bacterial invasion of epithelial cells
    18710 (Pik3r3)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    18710 (Pik3r3)
   05142 Chagas disease
    18710 (Pik3r3)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    18710 (Pik3r3)
   05017 Spinocerebellar ataxia
    18710 (Pik3r3)
   05020 Prion disease
    18710 (Pik3r3)
  09166 Cardiovascular disease
   05417 Lipid and atherosclerosis
    18710 (Pik3r3)
   05418 Fluid shear stress and atherosclerosis
    18710 (Pik3r3)
   05415 Diabetic cardiomyopathy
    18710 (Pik3r3)
  09167 Endocrine and metabolic disease
   04930 Type II diabetes mellitus
    18710 (Pik3r3)
   04932 Non-alcoholic fatty liver disease
    18710 (Pik3r3)
   04931 Insulin resistance
    18710 (Pik3r3)
   04933 AGE-RAGE signaling pathway in diabetic complications
    18710 (Pik3r3)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    18710 (Pik3r3)
   01524 Platinum drug resistance
    18710 (Pik3r3)
   01522 Endocrine resistance
    18710 (Pik3r3)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:mmu04131]
    18710 (Pik3r3)
Membrane trafficking [BR:mmu04131]
 Endocytosis
  Rab GTPases and associated proteins
   Rab associated proteins
    18710 (Pik3r3)
SSDB
Motif
Pfam: PI3K_P85_iSH2 SH2 Bap31_Bap29_C Transcrip_act Cupin_8 PI_PP_I Fez1 Mod_r
Other DBs
NCBI-GeneID: 18710
NCBI-ProteinID: NP_853616
MGI: 109277
Ensembl: ENSMUSG00000028698 ENSMUSG00000111410
UniProt: Q64143 Q3UXE9
Position
4:116078593..116160253
AA seq 461 aa
MYNTVWSMDRDDADWREVMMPYSTELIFYIEMDPPALPPKPPKPMTPAVTNGMKDSFISL
QDAEWYWGDISREEVNDKLRDMPDGTFLVRDASTKMQGDYTLTLRKGGNNKLIKIYHRDG
KYGFSEPLTFTSVVELINHYHHESLAQYNPKLDVKLTYPVSRFQQDQLVKEDNIDAVGKN
LQEFHSQYQEKSKEYDRLYEEYTRTSQEIQMKRTAIEAFNETIKIFEEQCHTQEQHSKDY
IERFRREGNEKEIERIMMNYDKLKSRLGEIHDSKLRLEQDLKKQALDNREIDKKMNSIKP
DLIQLRKIRDQHLVWLNHRGVRQRRLNAWLGIKNEDSDESYFINEEDENLPHYDEKTWFV
EDINRVQAEDLLYGKPDGAFLIRESSKKGCYACSVVADGEVKHCVIYSTARGYGFAEPYN
LYSSLKELVLHYQQTSLVQHNDSLNVRLAYPVHAQMPTLCR
NT seq 1386 nt   +upstreamnt  +downstreamnt
atgtacaatacggtgtggagtatggaccgcgatgacgcagactggagggaggtgatgatg
ccctattcgacagaactgatattttatattgaaatggatcctccagctcttccaccaaag
ccacctaagccaatgactccagcagtcacaaatggaatgaaggacagtttcatttctctt
caagatgcagagtggtactggggagatatttccagggaagaggtaaatgacaaattgcgg
gacatgccagatggtaccttcttagttcgtgatgcctcaacgaaaatgcagggggattat
acattgactttgaggaagggaggaaataataaattaataaagatctatcatcgggatggt
aaatatggcttctctgagcccctgacgtttacttctgtggtggagcttattaaccactac
caccacgagtctctcgctcagtacaatcccaaactcgacgtgaagctgacgtacccagta
tccagattccaacaggatcagttggtaaaagaagataacattgatgcagtaggtaaaaat
ctgcaggagttccactctcagtatcaggagaagagcaaagagtatgacaggctgtatgaa
gagtacacaaggacatcacaggaaatacaaatgaagaggactgccattgaagcctttaat
gaaacaattaaaatatttgaggagcagtgtcatacccaagaacaacacagtaaagactat
atcgagcgctttcgcagagaggggaatgagaaggagatcgagcgaattatgatgaattat
gataaattgaaatcacgtcttggtgagattcatgatagcaaactgcgtcttgagcaggac
ttgaagaaacaagctttggacaaccgggaaatagataaaaaaatgaatagcatcaaaccc
gacttgatccagctgcgtaagatccgggatcagcaccttgtatggctcaatcacagagga
gtgaggcagaggcgcctgaatgcctggctggggatcaagaatgaggactcagatgaaagc
tattttatcaatgaggaagatgagaacctgccgcattatgatgagaaaacctggtttgtg
gaggatatcaaccgagtacaagcagaggacttgctttatgggaaaccagatggtgcattc
ttaattcgtgagagtagcaagaaaggatgttacgcttgttctgtggttgcagacggggaa
gtgaagcactgtgtcatctacagcacggctcgaggatatggctttgcagaaccctacaac
ctgtacagctcactgaaggagctggtgctccattaccagcagacatccctggttcagcac
aacgactccctcaacgtcaggctcgcctaccctgtccatgcacagatgcctacgctctgc
agataa

DBGET integrated database retrieval system