KEGG   Mus musculus (mouse): 18711
Entry
18711             CDS       T01002                                 

Gene name
Pikfyve, 5230400C17Rik, Pip5k, Pip5k3, Pipk5k3, PipkIII, p235
Definition
(RefSeq) phosphoinositide kinase, FYVE type zinc finger containing
  KO
K00921  1-phosphatidylinositol-3-phosphate 5-kinase [EC:2.7.1.150]
Organism
mmu  Mus musculus (mouse)
Pathway
mmu00562  Inositol phosphate metabolism
mmu01100  Metabolic pathways
mmu04070  Phosphatidylinositol signaling system
mmu04145  Phagosome
mmu04810  Regulation of actin cytoskeleton
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    18711 (Pikfyve)
 09130 Environmental Information Processing
  09132 Signal transduction
   04070 Phosphatidylinositol signaling system
    18711 (Pikfyve)
 09140 Cellular Processes
  09141 Transport and catabolism
   04145 Phagosome
    18711 (Pikfyve)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    18711 (Pikfyve)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:mmu04131]
    18711 (Pikfyve)
Enzymes [BR:mmu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.150  1-phosphatidylinositol-3-phosphate 5-kinase
     18711 (Pikfyve)
Membrane trafficking [BR:mmu04131]
 Endocytosis
  Macropinocytosis
   Kinases
    18711 (Pikfyve)
 Endosome - Golgi transport
  Others
   Others
    18711 (Pikfyve)
SSDB
Motif
Pfam: PIP5K Cpn60_TCP1 DEP FYVE 3-alpha
Other DBs
NCBI-GeneID: 18711
NCBI-ProteinID: NP_001297553
MGI: 1335106
Ensembl: ENSMUSG00000025949
Vega: OTTMUSG00000047694
UniProt: Q9Z1T6
Position
1; 1 C2
AA seq 2097 aa
MATDDKSSPTLDSANDLPRSPASPSHLTHFKPLTPDQDEPPFKSAYSSFVNLFRFNKERG
EGGQGEQQSPSSSWASPQIPSRTQSVRSPVPYKKQLNEELHRRSSVLDSRRKAEPACGGH
DPRTAVQLRSLSTVLKRLKEIMEGKSQDSDLKQYWMPDSQCKECYDCSEKFTTFRRRHHC
RLCGQIFCSRCCNQEIPGKFMGYTGDLRACTYCRKIALSYAHSTDSNSIGEDLNALSDST
CSVSILDPSEPRTPVGSRKASRNIFLEDDLAWQSLIHPDSSNSALSTRLVSVQEDAGKSP
ARNRSASITNLSLDRSGSPMVPSYETSVSPQANRNYIRTETTEDERKILLDSAQLKDLWK
KICHHTSGMEFQDHRYWLRTHPNCIVGKELVNWLIRNGHIATRAQAIAIGQAMVDGRWLD
CVSHHDQLFRDEYALYRPLQSTEFSETPSPDSDSVNSVEGHSEPSWFKDIKFDDSDTEQI
AEEGDDNLANSASPSKRTSVSSFQSTVDSDSAASISLNVELDNVNFHIKKPSKYPHVPPH
PADQKEYLVSDTGGQQLSISDAFIKESLFNRRVEEKSKELPFTPLGWHHNNLELLREENE
EKQAMERLLSANHNHMMALLQQLLQNESLSSSWRDIIVSLVCQVVQTVRPDVKHQDDDMD
IRQFVHIKKIPGGKKFDSVVVNGFVCTKNIAHKKMNSCIKNPKILLLKCSIEYLYREETK
FTCIDPIVLQEREFLKNYVQRIVDVRPTLVLVEKTVSRIAQDMLLEHGITLVINVKSQVL
ERISRMTQGDLVVSMDQLLTKPHLGTCHKFYMQIFQLPNEQTKTLMFFEGCPQHLGCTIK
LRGGSDYELARVKEILIFMICVAYHSQLEISFLMDEFAMPPTLMQSPSFHLLTEGRGEEG
ASQEQVSGSSLPQDPECPREALSSEDSTLLESRTVLEKGELDNKSIPQAVASLKHQDYTT
PTCPAGIPCALFALVPESLLPLHMDQQDAVGNEQPETSQQTDEQQDPKSQMKAFRDPLQD
DTGMYVTEEVTSSEDQRKTYALTFKQELKDVILCISPVITFREPFLLTEKGMRCSTRDYF
PEQIYWSPLLNKEVKEMESRRKKQLLRDLSGLQGMNGSVQAKSIQVLPSHELVSTRIAEH
LGDSQTLGRMLADYRARGGRIQSKHLDPFVHSKDASCTSGGKSGNKTESDEERGLIPSDV
IWPTKVDCLNPANHQRLCVLFSSSSAQSSNAPSACVSPWIVTMEFYGKNDLTLGIFLERY
CFRSSYQCPSMFCDTPMVHHIRRFVHGQGCVQIILKELDSPVPGYQHTILTYSWCRICKQ
VTPVVALSNESWSMSFAKYLELRFYGHQYTRRANAEPCGHSIHHDYHQYFSYNQMVASFS
YSPIRLLEVCVPLPKIFIKRQAPLKVSLLQDLKDFFQKVSQVYLAVDERLASLKTDTFSK
TREEKMEDIFAQKEMEEGEFKNWTEKMQARLMSSSVDTPQQLQSIFESLIAKKQSLCEVL
QAWNSRLQDLFQQEKGRKRPSVPPSPGRLRQGEESKINAMDTSPRNISPGLHNGEKEDRF
LTTLSSQSSTSSTHLQLPTPPEALAEQVVGGPTDLDSASGSEDVFDGHLLGSTDSQVKEK
STMKAIFANLLPGNSYNPIPFPFDPDKHYLMYEHERVPIAVCEKEPSSIIAFALSCKEYR
NALEELSKATLRNSAEEGLPANSALDNRPKSSSPIRLPEISGGQTNRTVEAEPQPTKKAS
GMLSFFRGTAGKSPDLSSQKRETLRGADSAYYQVGQAGKEGLESQGLEPQDEVDGGDTQK
KQLTNPHVELQFSDANAKFYCRLYYAGEFHKMREVILGSSEEEFIRSLSHSSPWQARGGK
SGAAFYATEDDRFILKQMPRLEVQSFLDFAPHYFNYITNAVQQKRPTALAKILGVYRIGY
KNSQNNTEKKLDLLVMENLFYGRKMAQVFDLKGSLRNRNVKTDTGKESCDVVLLDENLLK
MVRDNPLYIRSHSKSVLRTSIHSDAHFLSSHLIIDYSLLVGRDDTSNELVVGIIDYIRTF
TWDKKLEMVVKSTGILGGQGKMPTVVSPELYRTRFCEAMDKYFLMVPDHWTGLDLNC
NT seq 6294 nt   +upstreamnt  +downstreamnt
atggccacagatgacaagagttccccgacactggactctgctaatgatttgcctcgctct
cctgccagtccttctcacctcactcactttaaacccttgactcctgaccaggatgagccc
cccttcaagtcagcatatagttcttttgtaaacctttttcgttttaacaaagagcgagga
gaagggggccaaggagagcagcagtctccgagttcaagttgggccagccctcagatccct
tcaagaacacagtctgtgaggtcgcctgtaccttataaaaaacagcttaatgaggagctc
caccggcgctcttcagtgttagactccagaaggaaagcagaaccagcctgtggaggtcat
gacccacgtacagctgttcagcttcgaagcctcagcacagtattgaaacgcctcaaagaa
atcatggaaggaaaaagccaggacagtgacctgaagcaatattggatgccagatagccag
tgtaaagagtgctatgactgcagtgaaaagtttacaacatttaggcgcagacaccattgc
agactgtgtgggcagattttctgcagtcgttgttgtaatcaagaaatccctggaaaattt
atgggctatacaggagacctccgagcatgcacctactgtagaaaaatagccttaagttat
gctcattctacagacagtaattccattggggaagacttgaatgctctttcagattcaact
tgctctgtgtctatacttgatccaagcgaacctcggacaccagttgggagtagaaaagcc
agtcgtaacatattcttagaggatgatttagcctggcaaagcttgattcatccggattcc
tcaaatagtgctctttcaacaagactcgtatctgttcaagaggatgctgggaagtctcct
gctcgaaacagatcagccagcattactaatctgtcactggatcggtctggttctcctatg
gttccttcatatgagacatctgtcagtccccaggctaaccgaaactacattaggacagag
acgactgaggatgaacgcaaaattcttctggacagtgctcagttaaaggatctgtggaag
aaaatctgccatcacaccagtgggatggaatttcaagatcaccgttactggttgagaaca
catcccaactgcattgtagggaaggaattagtcaactggctaatcagaaatggacacatc
gctacaagggcacaagctatagcaattggacaagcaatggttgatggacgttggttggat
tgtgttagtcatcatgatcagcttttcagggacgaatatgcgttgtatagaccacttcag
agtacagaattttctgagacaccttctccagacagtgactctgtgaactctgtggaagga
cactccgagccatcctggtttaaagacataaaatttgatgacagtgacacagaacagatt
gctgaagaaggtgacgataatttggctaattctgccagtcctagcaagcgcacctcagtc
agcagtttccagtccacagtggacagtgactcagccgcttctatcagcctgaacgtggag
ctggacaacgtgaacttccatatcaagaagccctccaagtacccacatgtgccccctcac
cctgctgaccagaaagagtatttggtttctgacactggaggacagcagctctcaataagt
gatgccttcatcaaagagtccttatttaatcgacgagtagaggaaaaatccaaagagctg
ccttttacccctttgggctggcatcataacaacctggaactcttgcgagaggagaatgag
gagaagcaagccatggaaaggctgctttcagctaatcataaccacatgatggccctactc
cagcagttgcttcaaaacgagtcattgtcatcgtcttggagggacatcattgtgtcacta
gtctgccaggttgttcagacagtccgacctgatgtcaagcaccaggatgatgacatggat
atccgtcagtttgtccatatcaagaagatcccaggtggaaagaaatttgactctgtggtt
gtcaatggctttgtttgtaccaagaacattgcacataaaaagatgaattcctgtattaaa
aaccccaaaatccttctgttgaagtgttctattgagtatctctatagagaagaaactaag
tttacctgcattgatcctattgtgcttcaggaaagggaattcttgaagaattatgttcaa
cgaatagttgatgttcgacccacattggttcttgttgagaaaacagtgtctcggattgct
caggacatgttactggaacatggcattactctggtcattaatgtaaagtcacaagtttta
gaaagaatcagtcgaatgacccaaggtgatttagtggtgtccatggaccagctgctcacc
aaaccccacttgggcacttgccacaaattttatatgcagatatttcagctgcctaatgaa
caaaccaaaacactgatgttttttgaaggctgtccacagcatctaggctgcacaatcaag
ctcagaggaggctctgattatgagctggctcgagttaaggagatcctaatatttatgatc
tgtgtagcttatcattctcagctagaaatctcttttctcatggatgagttcgctatgcct
ccaacattaatgcaaagcccttcattccatcttctgacggagggacgaggtgaagaggga
gcctctcaggagcaggtcagtggcagctcccttcctcaggatcctgagtgccctcgtgag
gccctgtcttctgaggatagcactttgttggaatcaaggactgtgctagagaagggtgaa
ctagacaataaaagtattccacaagctgttgcctctttgaagcatcaagattataccacc
cccacttgcccagcaggtattccctgtgctctttttgcattggtaccagagtcattgttg
cctctccatatggatcaacaggatgccgtaggaaatgaacagccagagacttcacagcaa
acggatgagcaacaggatcccaaaagccagatgaaagcttttagagaccctttacaggat
gacactggaatgtacgttactgaggaagtcacctcctctgaagatcaacgaaagacttat
gccttgacatttaaacaggagttaaaagatgtaatcctctgtatctctccagttattaca
ttccgtgaacctttccttttaactgaaaaggggatgagatgctcaactcgagattatttt
ccagagcagatttactggtctcctcttctcaacaaagaggtgaaggaaatggagagcagg
aggaagaaacagctgctcagggatctctctggacttcagggcatgaatggcagtgttcag
gccaagtctattcaagtcttaccctcacatgagctagtgagcaccaggattgctgaacat
ctgggtgacagccagaccttgggtagaatgctagctgattatcgagctagaggaggaaga
attcagtcaaaacatttggacccctttgtccattcaaaagatgcatcatgtacttcaggt
ggcaaatcaggaaacaaaactgagagtgatgaagagaggggattgattccaagtgatgta
atatggccaacaaaggtggactgtctgaaccctgctaaccaccagaggctctgtgtgctc
ttcagcagctcttctgcccagtccagcaatgctcccagtgcttgtgtcagtccttggatt
gtaacaatggagttttatggaaagaatgaccttacactggggatatttttagaaagatac
tgtttcaggtcttcttaccagtgtccgagcatgttctgtgacacccccatggttcatcac
attcgacgctttgttcatggccaaggctgtgtacagataattctgaaggagttggattct
ccagtgcctggatatcaacatacaattctcacatattcctggtgcagaatctgcaaacaa
gtaacaccagttgttgctctttcaaatgaatcctggtctatgtcatttgcaaagtacctt
gaacttcgattttatggccaccagtacacacgcagagccaacgctgagccctgcggtcac
tctatccaccatgattatcaccagtatttctcttataaccagatggtggcatctttcagt
tactctcctattcggcttcttgaagtatgtgttccactaccaaaaatattcattaagcgt
caagccccactgaaggtatctcttcttcaggacctcaaagacttttttcagaaggtttca
caggtgtacctagctgttgatgagagacttgcatccttgaaaacggatacatttagcaaa
actagagaggaaaagatggaagatatctttgcacaaaaggagatggaagagggtgagttt
aagaactggacagagaagatgcaagcaaggctcatgtcttcctctgtggatacccctcag
caactgcagtccatttttgagtcactgattgccaagaagcaaagcctctgtgaggtgctc
caggcgtggaacagcaggttgcaggacctcttccagcaggaaaaaggtagaaagaggcct
tcagttcctcccagtcctgggagactgagacaaggtgaagaaagcaagataaatgcaatg
gacacatctccaaggaatatttctccaggacttcacaatggagaaaaagaggatcgcttc
ttgacaaccctgtccagccagagctctacgagctccacccacctccagctgcccactcct
cccgaggccctggccgagcaggtagtgggagggccgactgatctggattcagccagtggc
tctgaagatgtatttgatggtcatttgctgggatccacagacagccaggtgaaggaaaag
tcaaccatgaaagccatctttgctaatttgcttccaggaaacagctacaatcccattcca
tttccttttgatccagataaacactacttaatgtatgaacatgaacgggtgcccattgct
gtctgtgagaaagagcccagctccatcattgcttttgcactcagttgtaaagaataccgc
aatgccttagaggaattgtccaaagcaactctgcggaacagtgctgaagaagggctccca
gccaatagtgctttagataacagacctaagagtagcagccctattagactacctgaaatc
agtggaggacagacaaaccgcacagtagaagcagaacctcagccaaccaaaaaagcttca
ggaatgttgtccttcttcagaggaacagcagggaagagccctgatctgtcttcccagaag
agggagaccttgcgaggggcagacagtgcttactaccaggttgggcaggccggcaaggag
gggttggagagtcaaggcctggagcctcaagatgaagtagatggaggagatacacagaag
aaacaactcacaaatcctcatgtggaacttcaattttctgatgctaatgccaagttttac
tgtcggctgtactacgcgggagagttccacaagatgcgtgaagtgattctgggcagcagt
gaggaggaattcatccgttccctttctcactcatctccctggcaggcccggggaggcaag
tcaggagctgctttctatgccaccgaagatgatagattcattctgaagcaaatgcctcgt
ttggaagtccagtctttccttgactttgcaccacactacttcaattatatcacaaatgct
gttcaacaaaagaggcccaccgccttggctaaaattcttggagtttacagaattggttat
aagaactctcagaacaacactgagaagaagttagatctccttgtcatggaaaatcttttc
tatgggagaaagatggcacaggtttttgatttgaagggttcacttaggaatcgaaatgta
aaaactgacactgggaaagagagctgtgatgtggttctgttggatgaaaacctcctaaag
atggttcgagacaaccctctctatattcgttcccattccaaatctgtgctgagaacctcc
atccacagcgacgcccatttcctttccagccacctcattatagactattctctgctggtt
gggcgagatgacactagcaatgagcttgtggttggcatcatagattacattcgaacattt
acatgggacaaaaaacttgagatggttgtgaagtcaacaggaattttaggaggacaaggt
aaaatgccaactgtggtctctccagagttgtataggactagattttgtgaagcaatggac
aagtatttcttgatggtgccagaccactggacagggttggatctgaattgctga

DBGET integrated database retrieval system