KEGG   Mus musculus (mouse): 18717
Entry
18717             CDS       T01002                                 

Gene name
Pip5k1c, AI115456, AI835305, PIP5K, Pip5kIgamma
Definition
(RefSeq) phosphatidylinositol-4-phosphate 5-kinase, type 1 gamma
  KO
K00889  1-phosphatidylinositol-4-phosphate 5-kinase [EC:2.7.1.68]
Organism
mmu  Mus musculus (mouse)
Pathway
mmu00562  Inositol phosphate metabolism
mmu01100  Metabolic pathways
mmu04070  Phosphatidylinositol signaling system
mmu04072  Phospholipase D signaling pathway
mmu04144  Endocytosis
mmu04510  Focal adhesion
mmu04666  Fc gamma R-mediated phagocytosis
mmu04810  Regulation of actin cytoskeleton
mmu05135  Yersinia infection
mmu05231  Choline metabolism in cancer
Module
mmu_M00130  Inositol phosphate metabolism, PI=> PIP2 => Ins(1,4,5)P3 => Ins(1,3,4,5)P4
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    18717 (Pip5k1c)
 09130 Environmental Information Processing
  09132 Signal transduction
   04070 Phosphatidylinositol signaling system
    18717 (Pip5k1c)
   04072 Phospholipase D signaling pathway
    18717 (Pip5k1c)
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    18717 (Pip5k1c)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    18717 (Pip5k1c)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    18717 (Pip5k1c)
 09150 Organismal Systems
  09151 Immune system
   04666 Fc gamma R-mediated phagocytosis
    18717 (Pip5k1c)
 09160 Human Diseases
  09161 Cancer: overview
   05231 Choline metabolism in cancer
    18717 (Pip5k1c)
  09171 Infectious disease: bacterial
   05135 Yersinia infection
    18717 (Pip5k1c)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:mmu04131]
    18717 (Pip5k1c)
Enzymes [BR:mmu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.68  1-phosphatidylinositol-4-phosphate 5-kinase
     18717 (Pip5k1c)
Membrane trafficking [BR:mmu04131]
 Exocytosis
  Calcium ion-dependent exocytosis
   Kinases and associated proteins
    18717 (Pip5k1c)
 Endocytosis
  Clathrin-mediated endocytosis
   LDLR adaptor proteins
    18717 (Pip5k1c)
 Endosome - Golgi transport
  Others
   Others
    18717 (Pip5k1c)
SSDB
Motif
Pfam: PIP5K Toxin_33
Other DBs
NCBI-GeneID: 18717
NCBI-ProteinID: NP_032870
MGI: 1298224
Ensembl: ENSMUSG00000034902
Vega: OTTMUSG00000033475
UniProt: O70161
Position
10; 10 C1
AA seq 661 aa
MELEVPDEAESAEAGAVTAEAAWSAESGAAAGMTQKKAGLAEAPLVTGQPGPGHGKKLGH
RGVDASGETTYKKTTSSTLKGAIQLGIGYTVGNLSSKPERDVLMQDFYVVESIFFPSEGS
NLTPAHHFQDFRFKTYAPVAFRYFRELFGIRPDDYLYSLCNEPLIELSNPGASGSVFYVT
SDDEFIIKTVMHKEAEFLQKLLPGYYMNLNQNPRTLLPKFYGLYCVQSGGKNIRVVVMNN
VLPRVVKMHLKFDLKGSTYKRRASKKEKEKSLPTYKDLDFMQDMPEGLLLDSDTFGALVK
TLQRDCLVLESFKIMDYSLLLGVHNIDQQERERQAEGAQSKADEKRPVAQKALYSTAMES
IQGGAARGEAIETDDTMGGIPAVNGRGERLLLHIGIIDILQSYRFIKKLEHTWKALVHDG
DTVSVHRPSFYAERFFKFMSSTVFRKSSSLKSSPSKKGRGALLAVKPLGPTAAFSASQIP
SEREDVQYDLRGARSYPTLEDEGRPDLLPCTPPSFEEATTASIATTLSSTSLSIPERSPS
DTSEQPRYRRRTQSSGQDGRPQEEPHAEDLQKITVQVEPVCGVGVVPKEEGAGVEVPPCG
ASAAASVEIDAASQASEPASQASDEEDAPSTDIYFPTDERSWVYSPLHYSARPASDGESD
T
NT seq 1986 nt   +upstreamnt  +downstreamnt
atggagctagaggtgccggacgaggcggagagcgccgaagcgggggccgtgacggcggaa
gcggcctggtctgcggagagtggggcggcggcaggtatgacccagaagaaggctggcctt
gcagaggcccccttggtgacagggcagccaggccctggccatgggaagaagctgggccac
cgaggcgtggatgcgtcgggagagactacgtataagaagaccacctcgtccaccctgaag
ggcgccatccagctggggatcgggtacacggtgggcaacctgagctctaagccggagcgg
gacgtgctcatgcaggacttctacgtggtggagagcatcttcttccccagtgaagggagc
aacctcacccctgcccaccacttccaggatttccgcttcaagacctatgcacctgttgcc
ttccgctacttccgggagctctttggcatccgtccagatgactatttgtactccctgtgc
aatgagccactcatcgagctctccaaccccggggccagcggctctgtcttctacgtcacc
agcgacgacgagttcatcatcaagactgtcatgcacaaggaggcagagttcctgcagaag
ctgctgcctggctactacatgaatctcaaccagaacccacggacgctgctgcccaagttc
tatgggctgtactgcgtgcagtctggtggcaagaacatccgcgtggtggtcatgaacaat
gtgctgccccgtgtcgtcaaaatgcaccttaagttcgacctcaagggctccacgtacaag
cgcagggccagcaagaaggagaaggagaagagcctgcccacctacaaggacctggacttc
atgcaggacatgcccgaggggctgctgctggactccgacacctttggcgccctggtcaag
acgctgcagcgagactgcctggtgctggagagcttcaagataatggactacagcctgctg
ctgggcgtgcacaacatcgatcagcaggagcgagagcgccaggccgagggcgcccagagc
aaggcggatgagaagcggcccgtggcccagaaggctctgtattccacggccatggagtct
atccagggcggagctgcccgtggggaggccattgagacagatgacacgatgggtgggatt
ccagcagtgaatgggcgcggggagcgactgctcctccacatcgggatcattgatattctg
cagtcctacaggttcatcaagaagttagaacacacctggaaggccctcgtccatgatggg
gacactgtctcagtccaccggcccagcttctatgcagagcgcttcttcaagttcatgagc
agcacggtgttccggaagagttcctccctgaagtcctctccatccaagaaaggacgtggt
gccctgctggcggtcaaacccctggggcccactgctgccttctcagccagccagatcccc
agcgagagagaggatgtgcagtatgacctgcggggggcccgcagctaccccacgcttgag
gatgaaggccggcctgacctcctgccctgcaccccaccgtcctttgaggaagccaccaca
gcctccatcgccaccaccctgtcgtccacctccctctccatcccagagcggtccccttca
gatacatcggagcagccccggtacaggcggcgcacgcagtcttcaggccaggatggccgg
ccccaggaggagccccatgcggaagacctgcagaagataactgtgcaggtggagccagtg
tgcggtgtgggggttgtccccaaggaggagggtgcaggagtggaggtccccccatgtggg
gcatcggctgcagcctctgtggaaatagacgctgccagccaggcctcagagcctgccagc
caggcctcagatgaggaggatgcaccctctacagacatctattttcccaccgacgagagg
agctgggtgtactccccgcttcactatagcgcgcggcccgcctccgacggcgagagcgac
acataa

KEGG   Mus musculus (mouse): 18719
Entry
18719             CDS       T01002                                 

Gene name
Pip5k1b, PI4P5K-I[b], PIP5K1-beta, PIP5KIbeta, Pip, Pipk5b, STM7
Definition
(RefSeq) phosphatidylinositol-4-phosphate 5-kinase, type 1 beta
  KO
K00889  1-phosphatidylinositol-4-phosphate 5-kinase [EC:2.7.1.68]
Organism
mmu  Mus musculus (mouse)
Pathway
mmu00562  Inositol phosphate metabolism
mmu01100  Metabolic pathways
mmu04070  Phosphatidylinositol signaling system
mmu04072  Phospholipase D signaling pathway
mmu04144  Endocytosis
mmu04510  Focal adhesion
mmu04666  Fc gamma R-mediated phagocytosis
mmu04810  Regulation of actin cytoskeleton
mmu05135  Yersinia infection
mmu05231  Choline metabolism in cancer
Module
mmu_M00130  Inositol phosphate metabolism, PI=> PIP2 => Ins(1,4,5)P3 => Ins(1,3,4,5)P4
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    18719 (Pip5k1b)
 09130 Environmental Information Processing
  09132 Signal transduction
   04070 Phosphatidylinositol signaling system
    18719 (Pip5k1b)
   04072 Phospholipase D signaling pathway
    18719 (Pip5k1b)
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    18719 (Pip5k1b)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    18719 (Pip5k1b)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    18719 (Pip5k1b)
 09150 Organismal Systems
  09151 Immune system
   04666 Fc gamma R-mediated phagocytosis
    18719 (Pip5k1b)
 09160 Human Diseases
  09161 Cancer: overview
   05231 Choline metabolism in cancer
    18719 (Pip5k1b)
  09171 Infectious disease: bacterial
   05135 Yersinia infection
    18719 (Pip5k1b)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:mmu04131]
    18719 (Pip5k1b)
Enzymes [BR:mmu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.68  1-phosphatidylinositol-4-phosphate 5-kinase
     18719 (Pip5k1b)
Membrane trafficking [BR:mmu04131]
 Exocytosis
  Calcium ion-dependent exocytosis
   Kinases and associated proteins
    18719 (Pip5k1b)
 Endocytosis
  Clathrin-mediated endocytosis
   LDLR adaptor proteins
    18719 (Pip5k1b)
 Endosome - Golgi transport
  Others
   Others
    18719 (Pip5k1b)
SSDB
Motif
Pfam: PIP5K
Other DBs
NCBI-GeneID: 18719
NCBI-ProteinID: NP_032872
MGI: 107930
Ensembl: ENSMUSG00000024867
Vega: OTTMUSG00000031802
UniProt: P70181
Position
19; 19 B
AA seq 539 aa
MSSTAENGDAVPGKQNEEKTYKKTASSAIKGAIQLGIGYTVGNLTSKPERDVLMQDFYVV
ESVFLPSEGSNLTPAHHYPDFRFKTYAPLAFRYFRELFGIKPDDYLYSICSEPLIELSNP
GASGSLFFLTSDDEFIIKTVQHKEAEFLQKLLPGYYMNLNQNPRTLLPKFYGLYCMQSGG
INIRIVVMNNVLPRAMRMHLTYDLKGSTYKRRASRKEREKPNPTFKDLDFLQDMHEGLYF
DTETYNALMKTLQRDCRVLESFKIMDYSLLLGIHILDHSLKDKEEEPLQNVPDAKRPGMQ
KVLYSTAMESIQGPGKSADGIIAENPDTMGGIPAKSHKGEKLLLFMGIIDILQSYRLMKK
LEHSWKALVYDGDTVSVHRPSFYADRFLKFMNSRVFKKIQALKASPSKKRCNSIAALKAT
SQEIVSSISQEWKDEKRDLLTEGQSFSSLDEEALGSRHRPDLVPSTPSLFEAASLATTIS
SSSLYVGEHYPHDRTTLYSNSKGLPSSSTFTLEEGTIYLTAEPNTLDLQDDASVLDVYL
NT seq 1620 nt   +upstreamnt  +downstreamnt
atgtcgtcaactgctgaaaatggagacgccgtacctggaaaacaaaacgaagaaaaaacc
tacaaaaagacggcatcgtcagctattaaaggtgctatccagctgggaataggatacaca
gtgggcaacctcacgtccaagccagaacgcgatgtcctcatgcaagacttctacgtggtg
gaaagtgtgttcctccccagtgaagggagcaacctgaccccagcacatcactacccagac
ttcaggtttaagacctacgcaccgctggccttccggtacttccgagaactctttggtatc
aagcccgatgattacttgtactccatctgcagtgaacctctgatagaactgtccaatcct
ggagccagtgggtccttgtttttcttgaccagcgatgatgaatttatcatcaaaaccgtt
cagcataaggaagccgagttcctgcagaagctgctgccgggctattacatgaatttaaac
cagaatccaaggactcttctgccaaaattctatgggctgtattgcatgcagtcaggaggc
atcaacatccgcattgtggtgatgaacaatgtcctgccgcgtgccatgaggatgcatttg
acctatgacctgaaaggctccacatacaagcgaagagcatcccgaaaagagagggagaaa
cccaaccccacgtttaaggacctggacttcctgcaggacatgcacgaggggctgtatttc
gatacagaaacatacaatgcccttatgaagacactacagagagactgccgggttctggaa
agcttcaagatcatggactacagccttttgctgggtatccacatcttggaccattccctc
aaagacaaagaagaggagcccctccaaaacgtgcctgatgcaaagcggccggggatgcag
aaagtcctctattccacagccatggaatccatccagggtccaggcaagtctgcagatggg
atcattgcagagaatccagacacaatgggaggcattccagctaaaagccataagggagag
aagctgcttctattcatgggcattattgacatcctccaatcatataggttaatgaagaag
ttagaacattcctggaaagcccttgtttatgatggggacaccgtttcagttcatagacca
agtttttatgcagatagatttttaaagtttatgaattccagagttttcaagaaaattcaa
gctctgaaagcctcgccttctaagaaacgctgcaactccatcgctgcactgaaggcaacc
tcccaggagatcgtatcctccatcagccaggaatggaaggacgagaagcgggatttgtta
accgaaggacagagtttcagcagcctggatgaagaagccctgggatcccgacacaggccc
gacctggtacccagcactccatcattatttgaagctgcttccttagcgaccacaatatca
tcttcttccttatatgtcggcgaacactatccacatgacaggactaccctttactcaaac
agcaaagggttaccttccagttcaaccttcaccttggaagaggggaccatctacctgacg
gctgagccaaacaccctggacctgcaggatgatgcctctgtgctggacgtctatttataa

KEGG   Mus musculus (mouse): 18720
Entry
18720             CDS       T01002                                 

Gene name
Pip5k1a, PI4P5K-I[a], PIP5K1-alpha, PIP5KIalpha, Pi, Pipk5a
Definition
(RefSeq) phosphatidylinositol-4-phosphate 5-kinase, type 1 alpha
  KO
K00889  1-phosphatidylinositol-4-phosphate 5-kinase [EC:2.7.1.68]
Organism
mmu  Mus musculus (mouse)
Pathway
mmu00562  Inositol phosphate metabolism
mmu01100  Metabolic pathways
mmu04070  Phosphatidylinositol signaling system
mmu04072  Phospholipase D signaling pathway
mmu04144  Endocytosis
mmu04510  Focal adhesion
mmu04666  Fc gamma R-mediated phagocytosis
mmu04810  Regulation of actin cytoskeleton
mmu05135  Yersinia infection
mmu05231  Choline metabolism in cancer
Module
mmu_M00130  Inositol phosphate metabolism, PI=> PIP2 => Ins(1,4,5)P3 => Ins(1,3,4,5)P4
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    18720 (Pip5k1a)
 09130 Environmental Information Processing
  09132 Signal transduction
   04070 Phosphatidylinositol signaling system
    18720 (Pip5k1a)
   04072 Phospholipase D signaling pathway
    18720 (Pip5k1a)
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    18720 (Pip5k1a)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    18720 (Pip5k1a)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    18720 (Pip5k1a)
 09150 Organismal Systems
  09151 Immune system
   04666 Fc gamma R-mediated phagocytosis
    18720 (Pip5k1a)
 09160 Human Diseases
  09161 Cancer: overview
   05231 Choline metabolism in cancer
    18720 (Pip5k1a)
  09171 Infectious disease: bacterial
   05135 Yersinia infection
    18720 (Pip5k1a)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:mmu04131]
    18720 (Pip5k1a)
Enzymes [BR:mmu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.68  1-phosphatidylinositol-4-phosphate 5-kinase
     18720 (Pip5k1a)
Membrane trafficking [BR:mmu04131]
 Exocytosis
  Calcium ion-dependent exocytosis
   Kinases and associated proteins
    18720 (Pip5k1a)
 Endocytosis
  Clathrin-mediated endocytosis
   LDLR adaptor proteins
    18720 (Pip5k1a)
 Endosome - Golgi transport
  Others
   Others
    18720 (Pip5k1a)
SSDB
Motif
Pfam: PIP5K
Other DBs
NCBI-GeneID: 18720
NCBI-ProteinID: NP_032873
MGI: 107929
Ensembl: ENSMUSG00000028126
Vega: OTTMUSG00000019671
UniProt: P70182
Position
3; 3 F2.1
AA seq 546 aa
MASASSGPAAAGFSSLDAGAPAGTAAASGIKRATVSEGPSASVMPVKKIGHRSVDSSGET
TYKKTTSSALKGAIQLGITHTVGSLSTKPERDVLMQDFYVVESIFFPSEGSNLTPAHHYN
DFRFKTYAPVAFRYFRELFGIRPDDYLYSLCSEPLIELSNSGASGSLFYVSSDDEFIIKT
VQHKEAEFLQKLLPGYYMNLNQNPRTLLPKFYGLYCVQAGGKNIRIVVMNNLLPRSVKMH
MKYDLKGSTYKRRASQKEREKTLPTFKDLDFLQDIPDGLFLDADMYSALCKTLQRDCLVL
QSFKIMDYSLLMSIHNMDHAQREPTSNDTQYSADTRRPAPQKALYSTAMESIQGEARRGG
TVETEDHMGGIPARNNKGERLLLYIGIIDILQSYRFVKKLEHSWKALVHDGDTVSVHRPG
FYAERFQRFMCNTVFKKIPLKPSPTKKFRSGPSFSRRSGPSGNSCTSQLMASGEHRAQVT
TKAEVEPDVHLGRPDVLPQTPPLEEISEGSPVPGPSFSPVVGQPLQILNLSSTLEKLDVA
ESEFTH
NT seq 1641 nt   +upstreamnt  +downstreamnt
atggcgtccgcctcctcagggccagcggcggccgggttttcatcccttgatgccggggcc
cctgctggtaccgcagcagcatctggaatcaagagagccacagtatctgagggaccttcc
gcctctgtcatgcctgttaaaaaaataggccatcgaagtgttgattcctctggagagact
acatacaagaagacaacttcatcagccttgaaaggtgccatccagttaggcatcactcac
actgtgggcagcctgagcaccaaaccagagcgtgatgtcctcatgcaagacttctacgtg
gtggagagcatctttttccccagtgaaggcagcaacctgacaccggctcaccattacaat
gactttcgattcaagacctatgcgcctgttgccttccgttacttcagagagctctttggc
atccggcctgatgattacttgtactccctttgcagtgagccattgattgaactctccaat
tctggagctagtggttccctcttctatgtgtccagtgatgatgaattcatcattaagacc
gtccagcataaagaagcagaatttctgcagaagttgcttccaggatactacatgaatctt
aaccaaaaccctcgtactttgctgcccaaattttatggattgtactgtgtgcaagcaggc
ggcaagaacatacgaattgtggtgatgaacaatctcttgcctcggtcagtcaaaatgcat
atgaaatatgacctgaagggttcaacttacaagcggcgggcttctcagaaagaacgagag
aaaactctccccacctttaaagacctggacttcctacaagatatccctgacggcctattt
ttggatgctgacatgtacagtgctctgtgtaagactctacagcgtgactgtttggtgctg
cagagcttcaagataatggactacagcctgttgatgtccatccacaacatggaccatgca
cagagggagcccacgagcaatgacacacagtactcggctgacacgcgcagaccagcccca
cagaaggcgctctattccacagctatggaatccatccagggcgaggctcgacggggcggc
actgtggagactgaggaccacatgggtggcatccctgcccggaataacaaaggagaaagg
ctcctgctttatattggcatcattgatattcttcagtcctacaggtttgttaagaagttg
gagcactcttggaaagcactggtccatgatggggatacggtgtcagtgcatcgtccaggc
ttctatgctgagcggttccagcgtttcatgtgcaacacagtgttcaagaagattcccttg
aagccttctcctaccaaaaagtttcggtctggcccgtctttctctcggcgatcaggcccc
agcggcaactcctgcacctcccagctgatggcctctggggaacacagagcacaagtgacc
accaaggcggaagtggagccagatgtacaccttgggcgtcctgatgtcttacctcagact
ccacctttggaggaaataagtgagggttcacctgttcctggccccagtttctcacctgta
gttggacaacctttgcaaatactaaatttgagttcaaccttggaaaagcttgatgttgca
gagtcagagttcacccactga

DBGET integrated database retrieval system