KEGG   Mus musculus (mouse): 18718Help
Entry
18718             CDS       T01002                                 

Gene name
Pip4k2a, AW742916, Pip5k2a
Definition
(RefSeq) phosphatidylinositol-5-phosphate 4-kinase, type II, alpha
  KO
K00920  1-phosphatidylinositol-5-phosphate 4-kinase [EC:2.7.1.149]
Organism
mmu  Mus musculus (mouse)
Pathway
mmu00562  Inositol phosphate metabolism
mmu01100  Metabolic pathways
mmu04070  Phosphatidylinositol signaling system
mmu04810  Regulation of actin cytoskeleton
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    18718 (Pip4k2a)
 09130 Environmental Information Processing
  09132 Signal transduction
   04070 Phosphatidylinositol signaling system
    18718 (Pip4k2a)
 09140 Cellular Processes
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    18718 (Pip4k2a)
Enzymes [BR:mmu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.149  1-phosphatidylinositol-5-phosphate 4-kinase
     18718 (Pip4k2a)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PIP5K
Motif
Other DBs
NCBI-GeneID: 18718
NCBI-ProteinID: NP_032871
MGI: 1298206
Ensembl: ENSMUSG00000026737
Vega: OTTMUSG00000011477
UniProt: O70172 Q544E3
Position
2; 2 A3
AA seq 405 aa AA seqDB search
MATPGNLGSSVLASKTKTKKKHFVAQKVKLFRASDPLLSVLMWGVNHSINELSHVQIPVM
LMPDDFKAYSKIKVDNHLFNKENMPSHFKFKEYCPMVFRNLRERFGIDDQDFQNSLTRSA
PLPNDSQARSGARFHTSYDKRYVIKTITSEDVAEMHNILKKYHQYIVECHGVTLLPQFLG
MYRLNVDGVEIYVIVTRNVFSHRLSVYRKYDLKGSTVAREASDKEKAKELPTLKDNDFIN
EGQKIYIDDNNKKIFLEKLKKDVEFLAQLKLMDYSLLVGIHDVERAEQEEVECEENDGEE
EGESDSTHPIGTPPDSPGNTLNSSPPLAPGEFDPNIDVYAIKCHENAPRKEVYFMAIIDI
LTHYDAKKKAAHAAKTVKHGAGAEISTVNPEQYSKRFLDFIGHIL
NT seq 1218 nt NT seq  +upstreamnt  +downstreamnt
atggcgacccctggcaacctggggtcctccgtcctggcgagcaagaccaagacgaagaag
aagcacttcgtggctcagaaagtgaagctgttccgggccagcgacccgctgctcagcgtg
ctcatgtggggggtcaaccattcgatcaatgaactgagccacgttcaaatccctgtcatg
ttgatgcctgatgacttcaaagcctactcaaagataaaggttgacaaccacctttttaac
aaggaaaacatgccgagccatttcaagtttaaggaatactgcccaatggtcttccggaat
ctgcgggagaggtttggaatcgacgaccaagatttccagaattccttgaccagaagtgca
ccccttcccaatgactcccaggctcgcagcggggctcggtttcacacgtcttatgataaa
agatacgtcatcaagaccattaccagtgaggacgtggcagagatgcacaacatcctgaag
aagtaccaccagtatatagtggaatgtcatggggtcacacttcttcctcagttcttggga
atgtaccggcttaatgtcgatggagtggaaatatatgtgattgttacaaggaatgtgttc
agccaccggctatctgtatataggaaatacgacttaaagggctcgacagtggctagagaa
gctagtgataaagaaaaggccaaagagctgccaactttaaaggataatgacttcatcaat
gagggccaaaagatctatattgatgacaacaacaaaaagatattcctagaaaaactgaaa
aaggatgtcgagttccttgcacagttaaaactcatggactacagcctcctggtggggatt
cacgatgtggagcgagcagagcaggaggaggtggagtgtgaggagaacgatggggaagaa
gaaggagagagtgacagcacccacccgatcgggacgccaccagacagtcccggaaataca
ctcaacagctcaccacccttggctcctggagagtttgatccaaacattgatgtttatgca
attaaatgccatgagaatgcgcctagaaaagaggtatacttcatggcgattattgacatc
cttactcattacgatgcaaaaaagaaagctgcccacgctgcaaaaactgttaaacatggc
gctggagctgagatctcgactgtgaacccagagcagtattccaagcgctttttggacttt
attgggcacatcttgtaa

DBGET integrated database retrieval system