KEGG   Mus musculus (mouse): 18740Help
Entry
18740             CDS       T01002                                 

Gene name
Pitx1, Bft, P-OTX, Potx, Ptx1
Definition
(RefSeq) paired-like homeodomain transcription factor 1
  KO
K09356  paired-like homeodomain transcription factor 1
Organism
mmu  Mus musculus (mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:mmu03000]
    18740 (Pitx1)
Transcription factors [BR:mmu03000]
 Eukaryotic Type
  Helix-turn-helix
   Homeo domain only, not assigned
    18740 (Pitx1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Homeodomain OAR Homeobox_KN GAIN_A
Motif
Other DBs
NCBI-GeneID: 18740
NCBI-ProteinID: NP_035227
MGI: 107374
Ensembl: ENSMUSG00000021506
Vega: OTTMUSG00000037718
UniProt: P70314 Q3UQH0
Position
13 B1; 13 30.06 cM
AA seq 315 aa AA seqDB search
MDAFKGGMSLERLPEGLRPPPPPPHDMGPSFHLARAADPREPLENSASESSDADLPDKER
GGEAKGPEDGGAGSAGCGGGAEDPAKKKKQRRQRTHFTSQQLQELEATFQRNRYPDMSMR
EEIAVWTNLTEPRVRVWFKNRRAKWRKRERNQQLDLCKGGYVPQFSGLVQPYEDVYAAGY
SYNNWAAKSLAPAPLSTKSFTFFNSMSPLSSQSMFSAPSSISSMTMPSSMGPGAVPGMPN
SGLNNINNLTGSSLNSAMSPGACPYGTPASPYSVYRDTCNSSLASLRLKSKQHSSFGYGG
LQGPASGLNACQYNS
NT seq 948 nt NT seq  +upstreamnt  +downstreamnt
atggacgccttcaagggaggcatgagcctggagaggctaccggaggggctgcggccaccg
ccaccaccaccgcacgacatggggcccagcttccacctggcccgcgccgccgacccccgg
gagccgctggagaactccgccagcgaatcgtccgacgctgatctgccagacaaggagcgc
ggtggggaagccaaggggccagaggatggtggcgcgggcagtgctggctgcggcggcggt
gcagaggacccagctaagaagaagaaacagcggcggcaacgcactcacttcacaagccag
cagttgcaagagctggaggccacgttccaaaggaaccgctaccccgacatgagcatgaga
gaggagatcgcggtgtggaccaacctcactgaaccgcgagtgcgggtctggttcaagaac
cggcgagccaaatggcgcaagcgggagcggaaccagcagttggacctgtgcaagggcggc
tatgtgccgcagttcagcggcctggtgcagccctacgaggacgtgtacgctgccggctac
tcctacaacaactgggcggccaagagcctggccccggcgccgctgtctaccaagagcttt
accttcttcaactccatgagcccgctctcctctcaatccatgttctcggcccccagctcc
atctcttccatgaccatgccgtccagcatgggcccgggcgccgtgcccggcatgcccaac
tcgggcctcaacaacatcaacaacctcaccggctcctcgctcaactcggccatgtcgccg
ggcgcctgcccctacggcaccccagcctcgccctacagcgtctaccgggacacgtgcaac
tcgagccttgccagcctgcggctcaagtccaagcagcactcgtcgtttggctatggcggt
ctgcagggtccggcgtcggggctcaacgcttgccagtacaacagctga

DBGET integrated database retrieval system