KEGG   Mus musculus (mouse): 18746
Entry
18746             CDS       T01002                                 

Gene name
Pkm, AA414905, AL024370, AL024424, Pk, Pk-, Pk-2, Pk-3, Pk3, Pkm2
Definition
(RefSeq) pyruvate kinase, muscle
  KO
K00873  pyruvate kinase [EC:2.7.1.40]
Organism
mmu  Mus musculus (mouse)
Pathway
mmu00010  Glycolysis / Gluconeogenesis
mmu00230  Purine metabolism
mmu00620  Pyruvate metabolism
mmu01100  Metabolic pathways
mmu01200  Carbon metabolism
mmu01230  Biosynthesis of amino acids
mmu01240  Biosynthesis of cofactors
mmu04922  Glucagon signaling pathway
mmu04930  Type II diabetes mellitus
mmu05165  Human papillomavirus infection
mmu05203  Viral carcinogenesis
mmu05230  Central carbon metabolism in cancer
Module
mmu_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
mmu_M00002  Glycolysis, core module involving three-carbon compounds
mmu_M00049  Adenine ribonucleotide biosynthesis, IMP => ADP,ATP
mmu_M00050  Guanine ribonucleotide biosynthesis IMP => GDP,GTP
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    18746 (Pkm)
   00620 Pyruvate metabolism
    18746 (Pkm)
  09104 Nucleotide metabolism
   00230 Purine metabolism
    18746 (Pkm)
 09150 Organismal Systems
  09152 Endocrine system
   04922 Glucagon signaling pathway
    18746 (Pkm)
 09160 Human Diseases
  09161 Cancer: overview
   05203 Viral carcinogenesis
    18746 (Pkm)
   05230 Central carbon metabolism in cancer
    18746 (Pkm)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    18746 (Pkm)
  09167 Endocrine and metabolic disease
   04930 Type II diabetes mellitus
    18746 (Pkm)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:mmu04131]
    18746 (Pkm)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:mmu04147]
    18746 (Pkm)
Enzymes [BR:mmu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.40  pyruvate kinase
     18746 (Pkm)
Membrane trafficking [BR:mmu04131]
 Autophagy
  Chaperone mediated autophagy (CMA)
   Selective cargos
    18746 (Pkm)
Exosome [BR:mmu04147]
 Exosomal proteins
  Proteins found in most exosomes
   18746 (Pkm)
SSDB
Motif
Pfam: PK PK_C HpcH_HpaI
Other DBs
NCBI-GeneID: 18746
NCBI-ProteinID: NP_001240812
MGI: 97591
Ensembl: ENSMUSG00000032294
Vega: OTTMUSG00000063298
UniProt: P52480
Position
9 B; 9 32.03 cM
AA seq 531 aa
MPKPHSEAGTAFIQTQQLHAAMADTFLEHMCRLDIDSAPITARNTGIICTIGPASRSVEM
LKEMIKSGMNVARLNFSHGTHEYHAETIKNVREATESFASDPILYRPVAVALDTKGPEIR
TGLIKGSGTAEVELKKGATLKITLDNAYMEKCDENILWLDYKNICKVVEVGSKIYVDDGL
ISLQVKEKGADFLVTEVENGGSLGSKKGVNLPGAAVDLPAVSEKDIQDLKFGVEQDVDMV
FASFIRKAADVHEVRKVLGEKGKNIKIISKIENHEGVRRFDEILEASDGIMVARGDLGIE
IPAEKVFLAQKMMIGRCNRAGKPVICATQMLESMIKKPRPTRAEGSDVANAVLDGADCIM
LSGETAKGDYPLEAVRMQHLIAREAEAAMFHRLLFEELVRASSHSTDLMEAMAMGSVEAS
YKCLAAALIVLTESGRSAHQVARYRPRAPIIAVTRNPQTARQAHLYRGIFPVLCKDAVLN
AWAEDVDLRVNLAMDVGKARGFFKKGDVVIVLTGWRPGSGFTNTMRVVPVP
NT seq 1596 nt   +upstreamnt  +downstreamnt
atgccgaagccacacagtgaagcagggactgccttcattcagacccagcagctccatgca
gccatggctgacaccttcctggaacacatgtgccgcctggacattgactctgcccccatc
acggcccgcaacactggcatcatttgtaccattgggcctgcttcccgatctgtggagatg
ctgaaggagatgattaagtctggaatgaatgtggctcggctgaatttctctcatggaacc
catgagtaccatgcagagaccatcaagaatgtccgtgaagccacagaaagctttgcatct
gatcccattctctaccgtcctgttgcggtggctctggatacaaagggacctgagatccgg
actggactcatcaagggcagcggcaccgctgaggtggagctgaagaagggagccactctg
aagatcaccctggacaacgcttacatggagaagtgtgacgagaacatcctgtggctggac
tacaagaacatctgcaaggtggtggaggtgggcagcaagatctacgtggacgatgggctc
atctcactgcaggtgaaggagaaaggcgctgacttcctggtgacggaggtggagaatggt
ggctccttgggcagcaagaagggcgtgaacctgccgggcgctgctgtggatctccccgct
gtgtcggaaaaggacatccaggacctgaagtttggggtggagcaggatgtggacatggtg
tttgcatctttcatccgcaaggcagccgacgtgcatgaagtcaggaaggtgctgggagag
aagggcaagaacatcaagatcatcagcaaaatcgagaaccatgaaggcgtccgcaggttt
gatgagatcttggaggccagtgatgggatcatggtggctcgtggtgacctgggcattgag
attcctgcagagaaggtcttcctggctcagaagatgatgatcgggcgatgcaaccgagct
gggaagcctgtcatctgtgccacacagatgctggagagcatgatcaagaagccacgcccc
acccgtgctgaaggcagtgatgtggccaatgcagtcctggatggagcagactgcatcatg
ctgtctggagaaacagccaagggggactaccctctggaggctgttcgcatgcagcacctg
atagctcgggaggctgaggcagccatgttccaccgtctgctgtttgaagagcttgtgcga
gcctccagtcactccacagacctcatggaggccatggccatgggcagcgtggaggcctct
tataagtgtttagcagcagctttgatagttctcacggagtctggcaggagtgctcaccaa
gtggccaggtaccgccctcgggctcctatcattgccgtgactcgaaatccccagactgct
cgccaggcccatctgtaccgtggcatcttccctgtgctgtgtaaggatgccgtgctgaat
gcctgggctgaggatgtcgaccttcgtgtaaacttggccatggatgttggcaaggcccga
ggcttcttcaagaagggagatgtggtcattgtgctgaccgggtggcgccctggctctgga
ttcaccaacaccatgcgtgtagtgcctgtaccttga

DBGET integrated database retrieval system