KEGG   Mus musculus (house mouse): 18752
Entry
18752             CDS       T01002                                 
Symbol
Prkcg, PKCgamma, Pkcc, Prkcc
Name
(RefSeq) protein kinase C, gamma
  KO
K19663  classical protein kinase C gamma type [EC:2.7.11.13]
Organism
mmu  Mus musculus (house mouse)
Pathway
mmu01521  EGFR tyrosine kinase inhibitor resistance
mmu04010  MAPK signaling pathway
mmu04012  ErbB signaling pathway
mmu04014  Ras signaling pathway
mmu04015  Rap1 signaling pathway
mmu04020  Calcium signaling pathway
mmu04066  HIF-1 signaling pathway
mmu04070  Phosphatidylinositol signaling system
mmu04071  Sphingolipid signaling pathway
mmu04150  mTOR signaling pathway
mmu04270  Vascular smooth muscle contraction
mmu04310  Wnt signaling pathway
mmu04370  VEGF signaling pathway
mmu04510  Focal adhesion
mmu04540  Gap junction
mmu04613  Neutrophil extracellular trap formation
mmu04650  Natural killer cell mediated cytotoxicity
mmu04666  Fc gamma R-mediated phagocytosis
mmu04670  Leukocyte transendothelial migration
mmu04713  Circadian entrainment
mmu04720  Long-term potentiation
mmu04723  Retrograde endocannabinoid signaling
mmu04724  Glutamatergic synapse
mmu04725  Cholinergic synapse
mmu04726  Serotonergic synapse
mmu04727  GABAergic synapse
mmu04728  Dopaminergic synapse
mmu04730  Long-term depression
mmu04750  Inflammatory mediator regulation of TRP channels
mmu04911  Insulin secretion
mmu04916  Melanogenesis
mmu04918  Thyroid hormone synthesis
mmu04919  Thyroid hormone signaling pathway
mmu04921  Oxytocin signaling pathway
mmu04925  Aldosterone synthesis and secretion
mmu04928  Parathyroid hormone synthesis, secretion and action
mmu04929  GnRH secretion
mmu04935  Growth hormone synthesis, secretion and action
mmu04960  Aldosterone-regulated sodium reabsorption
mmu04961  Endocrine and other factor-regulated calcium reabsorption
mmu04970  Salivary secretion
mmu04971  Gastric acid secretion
mmu04972  Pancreatic secretion
mmu05017  Spinocerebellar ataxia
mmu05022  Pathways of neurodegeneration - multiple diseases
mmu05031  Amphetamine addiction
mmu05032  Morphine addiction
mmu05143  African trypanosomiasis
mmu05146  Amoebiasis
mmu05161  Hepatitis B
mmu05163  Human cytomegalovirus infection
mmu05170  Human immunodeficiency virus 1 infection
mmu05171  Coronavirus disease - COVID-19
mmu05200  Pathways in cancer
mmu05205  Proteoglycans in cancer
mmu05206  MicroRNAs in cancer
mmu05207  Chemical carcinogenesis - receptor activation
mmu05214  Glioma
mmu05223  Non-small cell lung cancer
mmu05225  Hepatocellular carcinoma
mmu05231  Choline metabolism in cancer
mmu05415  Diabetic cardiomyopathy
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    18752 (Prkcg)
   04012 ErbB signaling pathway
    18752 (Prkcg)
   04014 Ras signaling pathway
    18752 (Prkcg)
   04015 Rap1 signaling pathway
    18752 (Prkcg)
   04310 Wnt signaling pathway
    18752 (Prkcg)
   04370 VEGF signaling pathway
    18752 (Prkcg)
   04066 HIF-1 signaling pathway
    18752 (Prkcg)
   04020 Calcium signaling pathway
    18752 (Prkcg)
   04070 Phosphatidylinositol signaling system
    18752 (Prkcg)
   04071 Sphingolipid signaling pathway
    18752 (Prkcg)
   04150 mTOR signaling pathway
    18752 (Prkcg)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    18752 (Prkcg)
   04540 Gap junction
    18752 (Prkcg)
 09150 Organismal Systems
  09151 Immune system
   04613 Neutrophil extracellular trap formation
    18752 (Prkcg)
   04650 Natural killer cell mediated cytotoxicity
    18752 (Prkcg)
   04666 Fc gamma R-mediated phagocytosis
    18752 (Prkcg)
   04670 Leukocyte transendothelial migration
    18752 (Prkcg)
  09152 Endocrine system
   04911 Insulin secretion
    18752 (Prkcg)
   04929 GnRH secretion
    18752 (Prkcg)
   04921 Oxytocin signaling pathway
    18752 (Prkcg)
   04935 Growth hormone synthesis, secretion and action
    18752 (Prkcg)
   04918 Thyroid hormone synthesis
    18752 (Prkcg)
   04919 Thyroid hormone signaling pathway
    18752 (Prkcg)
   04928 Parathyroid hormone synthesis, secretion and action
    18752 (Prkcg)
   04916 Melanogenesis
    18752 (Prkcg)
   04925 Aldosterone synthesis and secretion
    18752 (Prkcg)
  09153 Circulatory system
   04270 Vascular smooth muscle contraction
    18752 (Prkcg)
  09154 Digestive system
   04970 Salivary secretion
    18752 (Prkcg)
   04971 Gastric acid secretion
    18752 (Prkcg)
   04972 Pancreatic secretion
    18752 (Prkcg)
  09155 Excretory system
   04960 Aldosterone-regulated sodium reabsorption
    18752 (Prkcg)
   04961 Endocrine and other factor-regulated calcium reabsorption
    18752 (Prkcg)
  09156 Nervous system
   04724 Glutamatergic synapse
    18752 (Prkcg)
   04727 GABAergic synapse
    18752 (Prkcg)
   04725 Cholinergic synapse
    18752 (Prkcg)
   04728 Dopaminergic synapse
    18752 (Prkcg)
   04726 Serotonergic synapse
    18752 (Prkcg)
   04720 Long-term potentiation
    18752 (Prkcg)
   04730 Long-term depression
    18752 (Prkcg)
   04723 Retrograde endocannabinoid signaling
    18752 (Prkcg)
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    18752 (Prkcg)
  09159 Environmental adaptation
   04713 Circadian entrainment
    18752 (Prkcg)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    18752 (Prkcg)
   05206 MicroRNAs in cancer
    18752 (Prkcg)
   05205 Proteoglycans in cancer
    18752 (Prkcg)
   05207 Chemical carcinogenesis - receptor activation
    18752 (Prkcg)
   05231 Choline metabolism in cancer
    18752 (Prkcg)
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    18752 (Prkcg)
   05214 Glioma
    18752 (Prkcg)
   05223 Non-small cell lung cancer
    18752 (Prkcg)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    18752 (Prkcg)
   05161 Hepatitis B
    18752 (Prkcg)
   05171 Coronavirus disease - COVID-19
    18752 (Prkcg)
   05163 Human cytomegalovirus infection
    18752 (Prkcg)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    18752 (Prkcg)
   05143 African trypanosomiasis
    18752 (Prkcg)
  09164 Neurodegenerative disease
   05017 Spinocerebellar ataxia
    18752 (Prkcg)
   05022 Pathways of neurodegeneration - multiple diseases
    18752 (Prkcg)
  09165 Substance dependence
   05031 Amphetamine addiction
    18752 (Prkcg)
   05032 Morphine addiction
    18752 (Prkcg)
  09166 Cardiovascular disease
   05415 Diabetic cardiomyopathy
    18752 (Prkcg)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    18752 (Prkcg)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:mmu01001]
    18752 (Prkcg)
Enzymes [BR:mmu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.13  protein kinase C
     18752 (Prkcg)
Protein kinases [BR:mmu01001]
 Serine/threonine kinases: AGC group
  PKC family [OT]
   18752 (Prkcg)
SSDB
Motif
Pfam: Pkinase C1_1 PK_Tyr_Ser-Thr C2 Pkinase_C ABC1 Kinase-like APH
Other DBs
NCBI-GeneID: 18752
NCBI-ProteinID: NP_035232
MGI: 97597
Ensembl: ENSMUSG00000078816
UniProt: P63318 Q3UN66
Position
7:3351982..3379615
AA seq 697 aa
MAGLGPGGGDSEGGPRPLFCRKGALRQKVVHEVKSHKFTARFFKQPTFCSHCTDFIWGIG
KQGLQCQVCSFVVHRRCHEFVTFECPGAGKGPQTDDPRNKHKFRLHSYSSPTFCDHCGSL
LYGLVHQGMKCSCCEMNVHRRCVRSVPSLCGVDHTERRGRLQLEIRAPTSDEIHITVGEA
RNLIPMDPNGLSDPYVKLKLIPDPRNLTKQKTKTVKATLNPVWNETFVFNLKPGDVERRL
SVEVWDWDRTSRNDFMGAMSFGVSELLKAPVDGWYKLLNQEEGEYYNVPVADADNCSLLQ
KFEACNYPLELYERVRMGPSSSPIPSPSPSPTDSKRCFFGASPGRLHISDFSFLMVLGKG
SFGKVMLAERRGSDELYAIKILKKDVIVQDDDVDCTLVEKRVLALGGRGPGGRPHFLTQL
HSTFQTPDRLYFVMEYVTGGDLMYHIQQLGKFKEPHAAFYAAEIAIGLFFLHNQGIIYRD
LKLDNVMLDAEGHIKITDFGMCKENVFPGSTTRTFCGTPDYIAPEIIAYQPYGKSVDWWS
FGVLLYEMLAGQPPFDGEDEEELFQAIMEQTVTYPKSLSREAVAICKGFLTKHPGKRLGS
GPDGEPTIRAHGFFRWIDWERLERLEIAPPFRPRPCGRSGENFDKFFTRAAPALTPPDRL
VLASIDQADFQGFTYVNPDFVHPDARSPTSPVPVPVM
NT seq 2094 nt   +upstreamnt  +downstreamnt
atggcgggtctgggccctggcggaggcgactcagaggggggaccccgacccctgttttgc
agaaagggggcgctgaggcagaaggtggtccacgaggtgaagagccacaagttcaccgct
cgtttcttcaagcagccaaccttctgcagtcactgtaccgacttcatctggggcattgga
aagcagggcctgcaatgtcaagtctgtagctttgtggttcaccgccgatgccacgaattt
gtgaccttcgagtgtccaggcgctggaaagggcccccagacggacgaccctcgcaacaag
cacaagttccgtctgcacagctacagcagtcccaccttctgcgaccactgtggctccctc
ctttacgggctggtgcaccagggcatgaaatgttcctgttgcgagatgaatgtgcaccgg
cgctgtgtgcgcagcgtgccctccctttgcggtgtggaccacacagagcgccgtggacgt
ctgcaactggaaatccgggctcctacgtcggatgagatccatattactgttggcgaggcc
cggaacctcattcctatggaccccaatggcctgtctgatccctacgtgaaactgaagctg
atcccggaccctcggaacctgacaaaacagaagacaaagaccgtgaaagccacactgaat
cccgtgtggaacgagaccttcgtgttcaacctgaagccaggggatgtagagcgccggctc
agtgtggaggtgtgggattgggataggacatcccgaaatgacttcatgggtgccatgtcc
tttggtgtctcagagctactcaaggcccctgtggatggatggtacaagttactgaaccag
gaggagggcgaatattacaatgtaccggtggccgatgctgacaactgcagcctcctccag
aagtttgaggcctgcaattaccccttggaattgtatgagagagtgcggatgggcccctct
tcctcccccatcccttctccatcccccagtcctacggactccaagcgatgcttctttggt
gccagcccaggacgcctgcatatctctgacttcagcttcctcatggttctagggaaaggc
agttttgggaaggtaatgctggcagagcgcagaggctccgacgaactctatgccatcaag
atactgaagaaagacgtcatcgtccaggatgacgatgtagactgcaccctcgtagagaag
cgtgtcctggcattgggaggccgaggtcctggaggccggccacactttctcacgcagctt
cactccacctttcagactccggaccgcctgtattttgtgatggagtatgtcactgggggc
gatttaatgtaccacatccagcaactgggcaagtttaaggagcctcatgcagcattctac
gctgcggaaatcgccataggcctcttcttccttcacaaccagggcatcatctacagggac
ctcaagttggataatgtgatgctggatgctgaaggacacatcaagatcacagactttggc
atgtgtaaagagaatgtcttccctgggtccacaacccgcaccttctgtggcaccccagac
tacatagcacctgagatcattgcctatcagccctacgggaagtctgtcgactggtggtct
tttggggtcctgctgtatgagatgttggcaggacagccaccctttgatggggaagatgag
gaagagttgtttcaagccatcatggaacaaactgtcacctatcccaagtcactttcccgg
gaagctgtggccatctgcaaagggttcctgaccaagcacccaggaaaacgcctgggctca
gggccagatggggaacccaccatccgggctcatggctttttccgttggatcgattgggag
aggttggagagactggaaattgcacctcctttcagaccacgtccgtgtggccgcagtggc
gaaaactttgacaagttcttcacgcgggcagcgccagcactgaccccgccagaccgcttg
gttctagccagcatcgaccaagctgatttccagggctttacttatgtgaacccggacttc
gtgcacccagatgcccgcagccccacaagccctgtgcccgtgcctgtcatgtaa

DBGET integrated database retrieval system