KEGG   Mus musculus (mouse): 18753Help
Entry
18753             CDS       T01002                                 

Gene name
Prkcd, AI385711, D14Ertd420e, PKC[d], PKCdelta, Pkcd
Definition
(RefSeq) protein kinase C, delta
  KO
K06068  novel protein kinase C delta type [EC:2.7.11.13]
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04062  Chemokine signaling pathway
mmu04140  Autophagy - animal
mmu04270  Vascular smooth muscle contraction
mmu04621  NOD-like receptor signaling pathway
mmu04625  C-type lectin receptor signaling pathway
mmu04666  Fc gamma R-mediated phagocytosis
mmu04722  Neurotrophin signaling pathway
mmu04750  Inflammatory mediator regulation of TRP channels
mmu04912  GnRH signaling pathway
mmu04915  Estrogen signaling pathway
mmu04930  Type II diabetes mellitus
mmu04931  Insulin resistance
mmu04933  AGE-RAGE signaling pathway in diabetic complications
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    18753 (Prkcd)
 09150 Organismal Systems
  09151 Immune system
   04621 NOD-like receptor signaling pathway
    18753 (Prkcd)
   04625 C-type lectin receptor signaling pathway
    18753 (Prkcd)
   04666 Fc gamma R-mediated phagocytosis
    18753 (Prkcd)
   04062 Chemokine signaling pathway
    18753 (Prkcd)
  09152 Endocrine system
   04912 GnRH signaling pathway
    18753 (Prkcd)
   04915 Estrogen signaling pathway
    18753 (Prkcd)
  09153 Circulatory system
   04270 Vascular smooth muscle contraction
    18753 (Prkcd)
  09156 Nervous system
   04722 Neurotrophin signaling pathway
    18753 (Prkcd)
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    18753 (Prkcd)
 09160 Human Diseases
  09167 Endocrine and metabolic disease
   04930 Type II diabetes mellitus
    18753 (Prkcd)
   04931 Insulin resistance
    18753 (Prkcd)
   04933 AGE-RAGE signaling pathway in diabetic complications
    18753 (Prkcd)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:mmu01001]
    18753 (Prkcd)
Enzymes [BR:mmu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.13  protein kinase C
     18753 (Prkcd)
Protein kinases [BR:mmu01001]
 Serine/threonine kinases: AGC group
  PKC family [OT]
   18753 (Prkcd)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr C1_1 Pkinase_C C1_2 zf-RING-like Kinase-like Zf_RING PHD zf-RING_9 DUF2318 Pkinase_fungal Haspin_kinase DZR APH CxC3 FYVE_2
Motif
Other DBs
NCBI-GeneID: 18753
NCBI-ProteinID: NP_035233
MGI: 97598
Ensembl: ENSMUSG00000021948
Vega: OTTMUSG00000025129
UniProt: P28867 Q53YN4
Structure
PDB: 

Position
14 B; 14 18.82 cM
AA seq 674 aa AA seqDB search
MAPFLRISFNSYELGSLQVEDEASQPFCAVKMKEALSTERGKTLVQKKPTMYPEWKTTFD
AHIYEGRVIQIVLMRAAEDPVSEVTVGVSVLAERCKKNNGKAEFWLDLQPQAKVLMCVQY
FLEDGDCKQSMRSEEEAKFPTMNRRGAIKQAKIHYIKNHEFIATFFGQPTFCSVCKEFVW
GLNKQGYKCRQCNAAIHKKCIDKIIGRCTGTATNSRDTIFQKERFNIDMPHRFKVYNYMS
PTFCDHCGSLLWGLVKQGLKCEDCGMNVHHKCREKVANLCGINQKLLAEALNQVTQRSSR
KLDTTESVGIYQGFEKKPEVSGSDILDNNGTYGKIWEGSTRCTLENFTFQKVLGKGSFGK
VLLAELKGKDKYFAIKCLKKDVVLIDDDVECTMVEKRVLALAWESPFLTHLICTFQTKDH
LFFVMEFLNGGDLMFHIQDKGRFELYRATFYAAEIICGLQFLHSKGIIYRDLKLDNVMLD
RDGHIKIADFGMCKENIFGEGRASTFCGTPDYIAPEILQGLKYSFSVDWWSFGVLLYEML
IGQSPFHGDDEDELFESIRVDTPHYPRWITKESKDIMEKLFERDPDKRLGVTGNIRIHPF
FKTINWSLLEKRKVEPPFKPKVKSPSDYSNFDPEFLNEKPQLSFSDKNLIDSMDQEAFHG
FSFVNPKFEQFLDI
NT seq 2025 nt NT seq  +upstreamnt  +downstreamnt
atggcacccttcctgcgcatctccttcaattcctatgagctgggctccctgcaagttgag
gacgaagcaagccagcctttctgtgctgtgaagatgaaggaggcactcagcacagagcga
gggaagacactggtacagaagaagcccaccatgtatcctgagtggaagacaacgttcgac
gcccacatctatgaaggccgtgttatccagattgtgctgatgcgggcagctgaagacccc
gtgtctgaggtcacggtgggcgtgtcagtactggctgagcgctgcaagaagaacaacggc
aaggctgagttctggctggatctgcagcctcaggccaaggtgctgatgtgtgtgcagtat
ttcctggaggatggggattgcaaacagtctatgcgtagtgaggaggaggcaaagtttcca
accatgaaccgtcgtggagccattaaacaggccaagatccactacatcaagaaccacgag
tttatcgccaccttcttcgggcagcccaccttctgttctgtgtgcaaagagtttgtctgg
ggcctcaacaagcaaggctacaaatgcaggcaatgcaacgctgccatccacaagaaatgc
attgacaagattatcggccgctgcactggcactgccaccaatagccgggacaccatcttc
cagaaagaacgcttcaacatcgacatgcctcaccgattcaaggtttataactacatgagc
cccaccttctgtgaccactgtggcagtttgctctggggactggtgaagcagggattaaag
tgtgaagattgtggcatgaatgtgcaccacaaatgccgggagaaggtggccaacctgtgt
ggtatcaaccaaaagctcttggctgaggccttgaaccaagtgacccagagatcttcccgg
aagctggacacaacagagtctgtcggaatataccagggatttgagaagaagccagaagtc
tctgggagtgacatcctagacaacaacgggacctatggcaagatctgggaggggagcacc
cggtgcacccttgagaacttcaccttccaaaaagtacttggcaaaggcagctttggcaag
gtgctgctggcagagctgaagggcaaagacaagtactttgcaatcaagtgtctgaagaag
gacgtggtgttgattgacgatgatgtagagtgtaccatggtggagaagcgggtgctggcg
ctcgcctgggagagtcccttcctcacccacctcatctgtaccttccagaccaaggaccac
ctgttcttcgtgatggagtttctcaatgggggtgacctgatgttccacattcaggacaaa
ggccgcttcgaactctaccgggctacgttttatgcagctgagatcatctgcggactgcag
tttctacacagcaaaggcattatttacagggacctcaagctggacaatgtgatgctagac
agggacggccacatcaagatcgctgactttgggatgtgcaaagagaatatatttggggag
ggccgggccagcacattctgcggcactcctgactacatcgcccctgagatcctgcagggc
ctgaagtactccttctcggtggactggtggtctttcggggtcctcctgtacgaaatgctc
atcggccagtcccccttccacggcgacgatgaggacgagctcttcgagtccatccgggtg
gacacaccacactatccccgttggatcaccaaggaatccaaggacatcatggagaagcta
ttcgagagggaccctgacaagaggctgggagtaacaggaaacatcaggattcaccccttt
ttcaagactatcaactggtccctcctggagaagcggaaggtggagccgccctttaagccc
aaagtgaaatccccttcagactacagcaactttgacccagagttcctgaatgagaaacct
cagctttccttcagtgacaagaacctcatcgactctatggaccaggaagccttccatggc
ttctcctttgtgaatcccaagtttgagcaattcctggacatttaa

DBGET integrated database retrieval system