KEGG   Mus musculus (mouse): 18755Help
Entry
18755             CDS       T01002                                 

Gene name
Prkch, Pkch
Definition
(RefSeq) protein kinase C, eta
  KO
K18051  novel protein kinase C eta type [EC:2.7.11.13]
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04270  Vascular smooth muscle contraction
mmu04750  Inflammatory mediator regulation of TRP channels
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09150 Organismal Systems
  09153 Circulatory system
   04270 Vascular smooth muscle contraction
    18755 (Prkch)
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    18755 (Prkch)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:mmu01001]
    18755 (Prkch)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:mmu04147]
    18755 (Prkch)
Enzymes [BR:mmu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.13  protein kinase C
     18755 (Prkch)
Protein kinases [BR:mmu01001]
 Serine/threonine kinases: AGC group
  PKC family [OT]
   18755 (Prkch)
Exosome [BR:mmu04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   18755 (Prkch)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr C1_1 C2 Pkinase_C Kinase-like FTA2 C1_2 Haspin_kinase APH Kdo RIO1
Motif
Other DBs
NCBI-GeneID: 18755
NCBI-ProteinID: NP_032882
MGI: 97600
Ensembl: ENSMUSG00000021108
Vega: OTTMUSG00000029341
UniProt: P23298 Q3UKY1
Position
12; 12 C3
AA seq 683 aa AA seqDB search
MSSGTMKFNGYLRVRIGEAVGLQPTRWSLRHSLFKKGHQLLDPYLTVSVDQVRVGQTSTK
QKTNKPTYNEEFCANVTDGGHLELAVFHETPLGYDHFVANCTLQFQELLRTAGTSDTFEG
WVDLEPEGKVFVVITLTGSFTEATLQRDRIFKHFTRKRQRAMRRRVHQVNGHKFMATYLR
QPTYCSHCREFIWGVFGKQGYQCQVCTCVVHKRCHHLIVTACTCQNNINKVDAKIAEQRF
GINIPHKFNVHNYKVPTFCDHCGSLLWGIMRQGLQCKICKMNVHIRCQANVAPNCGVNAV
ELAKTLAGMGLQPGNISPTSKLISRSTLRRQGKEGSKEGNGIGVNSSSRFGIDNFEFIRV
LGKGSFGKVMLARIKETGELYAVKVLKKDVILQDDDVECTMTEKRILSLARNHPFLTQLF
CCFQTPDRLFFVMEFVNGGDLMFHIQKSRRFDEARARFYAAEIISALMFLHEKGIIYRDL
KLDNVLLDHEGHCKLADFGMCKEGICNGVTTATFCGTPDYIAPEILQEMLYGPAVDWWAM
GVLLYEMLCGHAPFEAENEDDLFEAILNDEVVYPTWLHEDATGILKSFMTKNPTMRLGSL
TQGGEHEILRHPFFKEIDWAQLNHRQLEPPFRPRIKSREDVSNFDPDFIKEEPVLTPIDE
GHLPMINQDEFRNFSYVSPELQL
NT seq 2052 nt NT seq  +upstreamnt  +downstreamnt
atgtcgtccggcacgatgaagttcaatggctatctgagggtccgcatcggagaggctgta
gggctgcagcccacccgctggtccctgcggcactcgctcttcaaaaagggccaccagctg
ctggacccctacctgacggtgagcgtagaccaggtacgcgtgggccagaccagcacaaag
cagaagaccaacaaacccacctacaacgaggagttctgcgccaatgtcaccgacggcggc
cacctggagctagccgtcttccacgagacgcccctgggttatgaccactttgtggccaac
tgcacgctgcagttccaggagctgttgcgcacggctggtacctcggacaccttcgagggc
tgggtggatctggagcctgaggggaaagtgtttgtggtaataaccctaacagggagtttc
actgaagccactctccagagagaccgcatcttcaagcattttaccaggaagcgccaaagg
gctatgcgaagacgagtccatcaagtgaacggacataagttcatggccacgtacctgagg
cagcccacctactgctctcattgccgagagttcatctggggagtatttgggaaacagggt
tatcaatgccaagtgtgcacctgcgtcgtccataaacgctgccatcatctaattgttaca
gcctgcacttgccaaaacaatattaacaaagtggatgccaagattgcagaacagcggttt
ggcatcaacatcccacacaagttcaacgttcacaattacaaggtgcccacgttctgtgac
cactgtggctccctgctctgggggataatgcgacaaggacttcagtgtaaaatatgtaag
atgaatgtacatattcggtgtcaggcgaacgtggccccaaactgcggggtgaatgccgtg
gagcttgccaagaccctggcagggatgggtctccaacccggaaatatttctccaacctcg
aaactcatttccaggtcgacactaagacggcagggaaaggagggctccaaagaaggaaat
gggatcggtgttaactcttccagcagattcggcatcgacaactttgagttcatccgggtg
ttggggaaggggagcttcgggaaggtgatgcttgccaggataaaggagacaggagaactg
tacgccgtgaaggtgctgaagaaggacgtgattctgcaggatgatgatgtagagtgcacc
atgactgagaagaggatcctgtccttggcccgcaaccaccccttcctcacccagctcttc
tgctgctttcagactccagaccgtctgttctttgtcatggagtttgtgaacggaggcgac
ctgatgttccacatccaaaagtcccgtcgtttcgatgaagcccgtgctcgtttctacgcc
gcggagatcatttctgcactcatgttcctacatgagaaaggtatcatctatagagacttg
aaactggacaatgtgctattggaccacgaaggtcactgtaaactggccgactttggaatg
tgcaaggaggggatttgtaatggggtcaccacagccaccttctgcggtacacccgactac
attgccccggagatccttcaggagatgctgtatggacctgcagtagactggtgggccatg
ggtgtgttgctttatgagatgctgtgcggacatgcgccctttgaggctgaaaatgaagat
gacctttttgaggccatactgaatgatgaagtcgtctaccccacctggctccacgaagat
gccacagggatcctcaagtctttcatgaccaagaaccccaccatgcgcttgggcagcctg
actcagggaggagagcatgagatcctgagacaccctttctttaaggaaatcgactgggcc
cagttgaaccatcgccagttagagccgcctttccgacctagaatcaaatcccgagaagat
gtcagcaattttgacccagactttataaaagaagagcccgtcttaactccgattgatgag
ggacatcttcctatgattaaccaggatgagtttagaaacttttcctatgtgtcaccggaa
ttgcaactgtag

DBGET integrated database retrieval system