KEGG   Mus musculus (mouse): 18760Help
Entry
18760             CDS       T01002                                 

Gene name
Prkd1, PKD, PKD1, Pkcm, Prkcm
Definition
(RefSeq) protein kinase D1
  KO
K06070  protein kinase D [EC:2.7.11.13]
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04015  Rap1 signaling pathway
mmu04925  Aldosterone synthesis and secretion
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04015 Rap1 signaling pathway
    18760 (Prkd1)
 09150 Organismal Systems
  09152 Endocrine system
   04925 Aldosterone synthesis and secretion
    18760 (Prkd1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:mmu01001]
    18760 (Prkd1)
Enzymes [BR:mmu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.13  protein kinase C
     18760 (Prkd1)
Protein kinases [BR:mmu01001]
 Serine/threonine kinases: CAMK group
  PKD family
   18760 (Prkd1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr C1_1 PH Kinase-like C1_2 Kdo zf-RING_9 PHD
Motif
Other DBs
NCBI-GeneID: 18760
NCBI-ProteinID: NP_032884
MGI: 99879
Ensembl: ENSMUSG00000002688
UniProt: Q62101
Position
12; 12 B3
AA seq 918 aa AA seqDB search
MSVPPLLRPPSPLLPAAAAVAAAAAALVPGSGPAPFPAPGAAPAGGISFHLQIGLSREPV
LLLQDSSGDYSLAHVREMACSIVDQKFPECGFYGLYDKILLFRHDPASDNILQLVKIASD
IQEGDLIEVVLSASATFEDFQIRPHALFVHSYRAPAFCDHCGEMLWGLVRQGLKCEGCGL
NYHKRCAFKIPNNCSGVRRRRLSNVSLTGLGTVRTASAEFSTSVPDEPLLSPVSPGFEQK
SPSESFIGREKRSNSQSYIGRPIQLDKLLMSKVKVPHTFVIHSYTRPTVCQFCKKLLKGL
FRQGLQCKDCRFNCHKRCAPKVPNNCLGEVTINGELLSPGAESDVVMEEGSDDNDSERNS
GLMDDMDEAMVQDTEMALAEGQSGGAEMQDPDADQEDSNRTISPSTSNNIPLMRVVQSVK
HTKRRSSTVMKEGWMVHYTSKDTLRKRHYWRLDSKCITLFQNDTGSRYYKEIPLSEILCL
EPAKPSALTPVGATPHCFEITTANVVYYVGENVVNPSSSPPNNSVLPSGIGPDVARMWEV
AIQHALMPVIPKGSSVGSGSNSHKDISVSISVSNCQIQENVDISTVYQIFPDEVLGSGQF
GIVYGGKHRKTGRDVAIKIIDKLRFPTKQESQLRNEVAILQNLHHPGVVNLECMFETPER
VFVVMEKLHGDMLEMILSSEKGRLPEHITKFLITQILVALRHLHFKNIVHCDLKPENVLL
ASADPFPQVKLCDFGFARIIGEKSFRRSVVGTPAYLAPEVLRNKGYNRSLDMWSVGVIIY
VSLSGTFPFNEDEDIHDQIQNAAFMYPPNPWKEISHEAIDLINNLLQVKMRKRYSVDKTL
SHPWLQDYQTWLDLRELECRIGERYITHESDDSRWEQYAGEQGLQYPAHLISLSASHSDS
PEAEEREMKALSERVSIL
NT seq 2757 nt NT seq  +upstreamnt  +downstreamnt
atgagcgtccctccgctgctgcgaccgcctagcccgctcctgcccgccgcggccgccgtg
gctgctgccgccgctgcgctggtcccaggctccgggcccgcgcccttcccggcgcctggg
gccgccccggcggggggcatctcgttccatctgcagatcggcctgagccgcgagccggtg
ctgctcctgcaggactcctctggcgactacagcctggcgcatgtccgggagatggcttgt
tccatcgtggaccagaagttccccgaatgtggtttctatggactctatgataagatcctg
ctttttcggcacgatcctgcctccgacaacatccttcagctggtgaaaatcgcaagtgat
atccaggagggtgatctcattgaagtggtcctgtcagcttcagccaccttcgaagacttc
cagatccggccccatgctctcttcgttcattcatacagagccccagctttctgtgatcac
tgtggagaaatgctgtgggggctggtgcgtcaaggccttaaatgtgaaggatgtggtctg
aattaccataagagatgtgcatttaaaatccccaacaattgcagtggagttagaaggaga
agactctccaatgtgtccctcactggactcggtactgtccgcacagcatcggctgagttc
tccaccagtgtccctgatgagcctttactgtctcctgtgagccctggctttgagcaaaag
tctccatctgagtcatttatcggccgtgagaagaggtcaaattcgcagtcatacatcgga
cggccgattcagctcgacaagctcctgatgtctaaggtgaaggtgccacacacctttgtc
atccactcctacacacggcccacggtctgccagttctgtaagaagctcctcaagggcctc
ttccggcagggcttgcagtgcaaagattgcagattcaactgtcacaaacgctgcgcacca
aaagtaccaaacaactgcttgggtgaagtgaccatcaatggagaattacttagccctggt
gcagaatctgatgttgttatggaagaagggagtgatgacaatgacagtgagcggaacagt
gggctcatggatgacatggacgaggccatggtccaagatactgagatggctttggcagag
ggccagagtggaggtgcagagatgcaagatccagatgcagaccaggaggactccaacaga
accatcagcccttcaacgagcaacaacatcccgctcatgagggtagtgcagtctgtgaag
cacacgaagcggaggagcagcactgtgatgaaggaagggtggatggtccactacaccagc
aaggacacactgcggaaaaggcactactggagattggacagcaaatgcataacactcttc
caaaatgacacagggagccggtactacaaggaaattcctttatcagaaatattatgtctg
gaaccagcaaaaccttcagctttaactcccgttggagcgactcctcattgttttgaaatc
actacagcgaatgtagtgtattatgtgggagaaaacgtggttaacccatcaagttcccca
ccaaacaacagtgttctccccagtggcatcggtccggatgtggccaggatgtgggaggtg
gccatccagcatgctcttatgcccgtcatccccaagggctcctctgttggctccggatcc
aactcacacaaagatatttctgtgagcatttccgtttcaaattgccagattcaggaaaat
gtggatatcagcacagtctatcaaatatttcctgatgaagttctgggttccggacagttt
ggaattgtttatggaggtaaacatcgtaaaacaggaagagatgtagctattaagattatt
gacaaattaagatttcctacaaaacaagaaagtcagcttcgtaatgaggttgcaatttta
cagaaccttcatcaccctggtgttgtaaatttggagtgtatgtttgagacgcctgaaaga
gtgtttgttgttatggaaaaactccatggagacatgctggagatgatcttgtcaagtgaa
aagggcaggttgccagaacacataacgaagtttttaattactcagatactagtggctttg
cgacatcttcattttaaaaacatcgttcactgtgacctcaagccagaaaatgtgttgctg
gcatcagccgaccctttccctcaggtgaagctctgtgattttggttttgcccggatcatt
ggagagaagtcttttaggaggtcagtggtgggtaccccagcatacctggcacctgaagtt
ctgaggaacaagggctataaccgctctctggacatgtggtctgttggggtcatcatctat
gtgagcctgagtggtaccttcccttttaatgaagatgaagatatccatgatcagatccag
aatgcagccttcatgtatccacccaacccgtggaaggagatttctcatgaagccattgat
cttatcaataacttgctacaagtgaaaatgagaaaacgctacagtgtggataaaaccttg
agtcacccttggctacaggactatcagacctggttagatttacgagagctggaatgcaga
attggagaacgctatattacccacgaaagcgatgactccaggtgggaacagtacgcaggc
gagcaggggctgcagtacccggcgcacctgatcagtctgagtgctagccacagcgacagt
cctgaggctgaagagagagagatgaaagccctcagtgagcgtgtcagcatcctctga

DBGET integrated database retrieval system