KEGG   Mus musculus (mouse): 18762
Entry
18762             CDS       T01002                                 

Gene name
Prkcz, AI098070, C80388, Pkcz, R74924, aPKCzeta, nPKC-zeta, zetaPKC
Definition
(RefSeq) protein kinase C, zeta
  KO
K18952  atypical protein kinase C zeta type [EC:2.7.11.13]
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04015  Rap1 signaling pathway
mmu04062  Chemokine signaling pathway
mmu04071  Sphingolipid signaling pathway
mmu04144  Endocytosis
mmu04360  Axon guidance
mmu04390  Hippo signaling pathway
mmu04530  Tight junction
mmu04611  Platelet activation
mmu04910  Insulin signaling pathway
mmu04926  Relaxin signaling pathway
mmu04930  Type II diabetes mellitus
mmu04931  Insulin resistance
mmu04933  AGE-RAGE signaling pathway in diabetic complications
mmu05165  Human papillomavirus infection
mmu05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04015 Rap1 signaling pathway
    18762 (Prkcz)
   04390 Hippo signaling pathway
    18762 (Prkcz)
   04071 Sphingolipid signaling pathway
    18762 (Prkcz)
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    18762 (Prkcz)
  09144 Cellular community - eukaryotes
   04530 Tight junction
    18762 (Prkcz)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    18762 (Prkcz)
   04062 Chemokine signaling pathway
    18762 (Prkcz)
  09152 Endocrine system
   04910 Insulin signaling pathway
    18762 (Prkcz)
   04926 Relaxin signaling pathway
    18762 (Prkcz)
  09158 Development and regeneration
   04360 Axon guidance
    18762 (Prkcz)
 09160 Human Diseases
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    18762 (Prkcz)
  09167 Endocrine and metabolic disease
   04930 Type II diabetes mellitus
    18762 (Prkcz)
   04931 Insulin resistance
    18762 (Prkcz)
   04933 AGE-RAGE signaling pathway in diabetic complications
    18762 (Prkcz)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    18762 (Prkcz)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:mmu01001]
    18762 (Prkcz)
Enzymes [BR:mmu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.13  protein kinase C
     18762 (Prkcz)
Protein kinases [BR:mmu01001]
 Serine/threonine kinases: AGC group
  PKC family [OT]
   18762 (Prkcz)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr PB1 C1_1 Pkinase_C Kinase-like C1_2 APH Kdo
Other DBs
NCBI-GeneID: 18762
NCBI-ProteinID: NP_032886
MGI: 97602
Ensembl: ENSMUSG00000029053
Vega: OTTMUSG00000010601
UniProt: Q02956 Q3V341
Position
4 E2; 4 86.17 cM
AA seq 592 aa
MPSRTDPKMDRSGGRVRLKAHYGGDILITSVDAMTTFKDLCEEVRDMCGLHQQHPLTLKW
VDSEGDPCTVSSQMELEEAFRLVCQGRDEVLIIHVFPSIPEQPGMPCPGEDKSIYRRGAR
RWRKLYRANGHLFQAKRFNRGAYCGQCSERIWGLSRQGYRCINCKLLVHKRCHVLVPLTC
RRHMDSVMPSQEPPVDDKNDGVDLPSEETDGIAYISSSRKHDNIKDDSEDLKPVIDGVDG
IKISQGLGLQDFDLIRVIGRGSYAKVLLVRLKKNDQIYAMKVVKKELVHDDEDIDWVQTE
KHVFEQASSNPFLVGLHSCFQTTSRLFLVIEYVNGGDLMFHMQRQRKLPEEHARFYAAEI
CIALNFLHERGIIYRDLKLDNVLLDADGHIKLTDYGMCKEGLGPGDTTSTFCGTPNYIAP
EILRGEEYGFSVDWWALGVLMFEMMAGRSPFDIITDNPDMNTEDYLFQVILEKPIRIPRF
LSVKASHVLKGFLNKDPKERLGCRPQTGFSDIKSHAFFRSIDWDLLEKKQTLPPFQPQIT
DDYGLDNFDTQFTSEPVQLTPDDEDVIKRIDQSEFEGFEYINPLLLSAEESV
NT seq 1779 nt   +upstreamnt  +downstreamnt
atgcccagcaggacggaccccaagatggaccggagcggcggccgcgtccgtctgaaggcg
cactacggcggggacatcctgattaccagcgtggatgccatgacaacattcaaggacctc
tgtgaggaagtgcgagacatgtgtggcctgcaccagcagcacccactcaccctcaagtgg
gtggacagtgaaggtgacccttgtactgtgtcctcacagatggagctggaggaggccttc
cgcctggtctgtcagggcagggacgaagtgctcatcattcatgttttcccaagcatccca
gagcagccgggcatgccttgtcctggagaagacaagtccatctaccgccgtggagccaga
agatggaggaagctgtaccgagccaacggccacctcttccaagccaagcgctttaacagg
ggagcgtactgcggccagtgcagcgaaaggatatggggtctctcgaggcagggctacagg
tgcatcaactgcaagctgctggtccataaacgctgccacgtcctcgtcccgctgacctgc
aggaggcatatggattctgtcatgccttcccaagagcctccagtagatgacaagaacgat
ggtgtagaccttccttcagaagaaactgatggaattgcttatatttcttcatctcggaaa
catgataatatcaaagatgattctgaggaccttaagcctgtcatcgatggggtggatggg
atcaaaatctctcaggggctggggctgcaagacttcgacctcatcagagtcatcgggcgt
ggaagctatgccaaggtcctcctggtgcggttgaagaaaaacgaccagatttacgccatg
aaggtggtaaagaaggagcttgtccacgacgacgaggatatcgactgggtgcagacagag
aaacatgtgtttgagcaggcgtccagcaaccccttcctggttggcttacactcctgcttc
cagacaacgagccggttgttcctggtcatcgagtatgtcaatggcggggacctcatgttc
cacatgcagaggcagagaaaacttccagaggagcatgccaggttctatgctgctgagatc
tgtatcgctctcaacttcttgcatgagagggggatcatctaccgggacctaaaactggac
aacgtcctccttgatgccgacggacacattaagctgacggactacggcatgtgcaaggaa
ggtctaggccccggtgatacaacaagcactttttgtggaaccccgaactatatcgccccc
gaaatcctgcgaggagaagagtacgggttcagcgtggactggtgggcactgggtgtcctt
atgtttgagatgatggctgggcgctccccctttgacatcatcacggacaaccctgacatg
aacactgaagactaccttttccaagttatcctggaaaagccaatccggattccccgtttc
ctgtctgtcaaggcctcacacgtcttaaaaggatttttaaataaggatcccaaagagagg
cttggctgccggccacagactgggttttccgacatcaagtctcatgctttcttccgcagc
atagactgggacctgctggaaaagaagcagaccctgcctcccttccagccccagatcaca
gatgactatggcctggacaactttgacacgcagttcaccagcgagcctgtgcagctgacc
ccagatgatgaggacgtcataaagaggatcgaccagtccgaatttgaaggctttgagtac
atcaacccacttctgctgtctgctgaggagtccgtgtga

DBGET integrated database retrieval system