KEGG   Mus musculus (mouse): 18767Help
Entry
18767             CDS       T01002                                 

Gene name
Pkia, AI415001, PKIalpha
Definition
(RefSeq) protein kinase inhibitor, alpha
  KO
K15985  cAMP-dependent protein kinase inhibitor alpha
Organism
mmu  Mus musculus (mouse)
Pathway
mmu05034  Alcoholism
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09160 Human Diseases
  09165 Substance dependence
   05034 Alcoholism
    18767 (Pkia)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PKI
Motif
Other DBs
NCBI-GeneID: 18767
NCBI-ProteinID: NP_032888
MGI: 104747
Ensembl: ENSMUSG00000027499
Vega: OTTMUSG00000051305
UniProt: P63248
Structure
PDB: 

Position
3; 3 A1
AA seq 76 aa AA seqDB search
MTDVETTYADFIASGRTGRRNAIHDILVSSASGNSNELALKLAGLDINKTEGEDDGQRSS
TEQSGEAQGEAAKSES
NT seq 231 nt NT seq  +upstreamnt  +downstreamnt
atgactgatgtggaaactacgtatgcagatttcattgcttcaggaagaacaggtagaaga
aatgcaatacatgatatcctggtttcctctgcaagtggcaacagcaatgaattagcctta
aaactagcaggccttgatatcaacaagacagaaggtgaagatgatggacagagaagctcc
accgaacaaagtggagaagcccagggagaagcagccaagtctgaaagctaa

DBGET integrated database retrieval system