KEGG   Mus musculus (house mouse): 18769
Entry
18769             CDS       T01002                                 
Symbol
Pkig, PKIgamma
Name
(RefSeq) protein kinase inhibitor, gamma
Organism
mmu  Mus musculus (house mouse)
SSDB
Motif
Pfam: PKI
Other DBs
NCBI-GeneID: 18769
NCBI-ProteinID: NP_001034479
MGI: 1343086
Ensembl: ENSMUSG00000035268
Position
2:163500306..163568078
AA seq 76 aa
MMEVESSYSDFISCDRTGRRNAVPDIQGDSEAVSVRKLAGDMGELALEGAEGQAEGSTPD
KEASSQPESSDANTSS
NT seq 231 nt   +upstreamnt  +downstreamnt
atgatggaagtcgagtcctcctactcggacttcatctcctgcgaccggacaggccgtcgg
aatgcagtccctgacatccagggtgactcggaggccgtgagtgtgcggaagctcgctgga
gacatgggcgagctcgcacttgagggagcagaaggacaggcagagggaagtacccccgac
aaggaagccagcagccagcctgagagcagtgatgcgaacacctcatcctga

DBGET integrated database retrieval system