KEGG   Mus musculus (mouse): 18780
Entry
18780             CDS       T01002                                 

Gene name
Pla2g2a, EF, Mom1, Pla2, sPLA2, sPla2-IIA
Definition
(RefSeq) phospholipase A2, group IIA (platelets, synovial fluid)
  KO
K01047  secretory phospholipase A2 [EC:3.1.1.4]
Organism
mmu  Mus musculus (mouse)
Pathway
mmu00564  Glycerophospholipid metabolism
mmu00565  Ether lipid metabolism
mmu00590  Arachidonic acid metabolism
mmu00591  Linoleic acid metabolism
mmu00592  alpha-Linolenic acid metabolism
mmu01100  Metabolic pathways
mmu04014  Ras signaling pathway
mmu04270  Vascular smooth muscle contraction
mmu04972  Pancreatic secretion
mmu04975  Fat digestion and absorption
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    18780 (Pla2g2a)
   00565 Ether lipid metabolism
    18780 (Pla2g2a)
   00590 Arachidonic acid metabolism
    18780 (Pla2g2a)
   00591 Linoleic acid metabolism
    18780 (Pla2g2a)
   00592 alpha-Linolenic acid metabolism
    18780 (Pla2g2a)
 09130 Environmental Information Processing
  09132 Signal transduction
   04014 Ras signaling pathway
    18780 (Pla2g2a)
 09150 Organismal Systems
  09153 Circulatory system
   04270 Vascular smooth muscle contraction
    18780 (Pla2g2a)
  09154 Digestive system
   04972 Pancreatic secretion
    18780 (Pla2g2a)
   04975 Fat digestion and absorption
    18780 (Pla2g2a)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:mmu03036]
    18780 (Pla2g2a)
Enzymes [BR:mmu01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.4  phospholipase A2
     18780 (Pla2g2a)
Chromosome and associated proteins [BR:mmu03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Centriole proteins
    18780 (Pla2g2a)
Motif
Pfam: Phospholip_A2_1 Parvo_coat_N
Other DBs
NCBI-GeneID: 18780
NCBI-ProteinID: NP_001076000
MGI: 104642
Ensembl: ENSMUSG00000058908
Vega: OTTMUSG00000010068
UniProt: P31482 V5TDK8
Position
4 D3; 4 70.57 cM
AA seq 146 aa
MKVLLLLAASIMAFGSIQVQGNIAQFGEMIRLKTGKRAELSYAFYGCHCGLGGKGSPKDA
TDRCCVTHDCCYKSLEKSGCGTKLLKYKYSHQGGQITCSANQNSCQKRLCQCDKAAAECF
ARNKKTYSLKYQFYPNMFCKGKKPKC
NT seq 441 nt   +upstreamnt  +downstreamnt
atgaaggtcctcctgctgctagcagcctcgatcatggcctttggctcaatacaggtccaa
gggaacattgcgcagtttggggaaatgattcggcttaagacaggaaagagagctgagctt
agctatgccttctatggatgccactgtggcctgggtggcaaaggatcccccaaggatgcc
acagaccggtgctgtgttactcatgactgttgctacaagagcctggagaaaagtggatgt
ggtactaagttactgaaatacaagtactcccaccaagggggccaaatcacctgttctgca
aaccagaactcctgtcagaaacggctgtgtcagtgcgataaagccgccgctgaatgtttc
gcccggaacaagaaaacctacagtttaaagtaccagttctaccccaacatgttttgcaaa
gggaagaagcccaaatgctga

DBGET integrated database retrieval system