KEGG   Mus musculus (mouse): 18786
Entry
18786             CDS       T01002                                 

Gene name
Plaa, 2410007N06, AI536418, AU018445, AW208417, D4Ertd618, D4Ertd618e, PLA2P, PLAP, Ufd3
Definition
(RefSeq) phospholipase A2, activating protein
  KO
K14018  phospholipase A-2-activating protein
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04141  Protein processing in endoplasmic reticulum
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    18786 (Plaa)
SSDB
Motif
Pfam: PUL PFU WD40 WD40_like
Other DBs
NCBI-GeneID: 18786
NCBI-ProteinID: NP_766283
MGI: 104810
Ensembl: ENSMUSG00000028577
Vega: OTTMUSG00000007850
UniProt: P27612
Position
4 C5; 4 43.34 cM
AA seq 794 aa
MASGASRYRLSCSLPGHELDVRGLVCCLYPPGAFVSVSRDRTTRLWAPDSPNRGFTEMHC
MSGHSNFVSCVCIIPSSDIYPHGLIATGGNDHNICIFSLDSPMPLYILKGHKDTVCSLSS
GKFGTLLSGSWDTTAKVWLNDKCMMTLQGHTAAVWAVKILPEQGLMLTGSADKTIKLWKA
GRCERTFLGHEDCVRGLAILSETEFLSCANDASIRRWQITGECLEVYFGHTNYIYSISVF
PNSKDFVTTAEDRSLRIWKHGECAQTIRLPAQSIWCCCVLENGDIVVGASDGIIRVFTES
EERTASAEEIKAFERELSQATIDSKTGDLGDINAEQLPGREHLSEPGTREGQTRLIRDGE
RVEAYQWSVSDGRWIKIGDVVGSSGANQQTSGKVLYEGKEFDYVFSIDVNEGGPSYKLPY
NVSDDPWLVAYNFLQKNDLNPMFLDQVAKFIIDNTKGQTLGLGNTSFSDPFTGGGRYVPG
TSGPSNTVQTADPFTGAGRYMPGSAGMDTTMTGVDPFTGNSAYRSAASKTVNIYFPKKEA
LTFDQANPTQILGKLKELNGTAPEEKKLTEDDLVLLEKILSLICNNSSEKPTAQQLQILW
KAINWPEDIVFPALDILRLSIKHPNVNENFCNEKGDQFSSHLINLLNPKGKPANQLLALR
TFCNCFVSQAGQKLMMSQRESLMSHAIELKSGSNKNIHIALATLTLNYSVCFHKDHNIEG
KAQCLSVISTILEVVQDLEATFRLLVALGTLISDDSNAIQLAKSLGVDSQIKKYVSVSEP
AKVSECCRLVLHLL
NT seq 2385 nt   +upstreamnt  +downstreamnt
atggcgagcggcgcctccagataccggctgagctgctcgctcccgggccacgaactggac
gtgaggggcctggtgtgctgcctctacccgccgggagcctttgtgtctgtgtcccgggat
cggaccacccgcctctgggctccagacagtcctaacaggggctttacagaaatgcactgt
atgagcggccactctaattttgtgtcttgtgtgtgtatcataccctcaagtgacatatat
cctcatggactgattgccactggaggaaatgaccacaatatttgcattttctcgctggac
agtccaatgccactttatattttaaagggtcacaaagatactgtttgtagtctttcttct
ggaaaatttgggacattacttagtggctcatgggacaccactgctaaagtctggctgaat
gacaaatgcatgatgacattacagggtcatacagccgcagtatgggcagtaaagatttta
cctgaacagggcttaatgctaactggatcagcagacaagaccattaaactatggaaggct
ggaagatgtgagaggacttttttagggcatgaagactgtgtaagaggcttggcaatcttg
agtgagacagaatttctttcctgtgcaaacgatgctagtattagaaggtggcagatcact
ggcgagtgtctggaagtatactttggacatacaaattatatttatagcatatctgtcttt
ccaaactccaaagattttgtgaccactgcagaagacagatctctaagaatatggaaacat
ggtgaatgcgcccaaacaatccgacttccagctcagtctatatggtgttgctgcgtactg
gaaaatggtgacattgtggttggtgcgagtgatggtattattagggtgtttacagagtca
gaggagcggacagcaagtgctgaggaaatcaaagcttttgagagagagctctctcaggca
actatcgattccaaaactggtgacttgggggatattaatgcggagcagcttcctgggagg
gaacatctcagtgagccaggtactagagaaggacagactcgtctaatcagagatggagag
agagttgaagcctatcagtggagtgttagtgacgggaggtggataaaaattggtgatgtt
gttggctcatctggtgctaatcagcaaacatctggaaaagttttatatgaagggaaagaa
tttgattatgttttctcaatcgatgtgaatgaaggtggaccatcgtataaattaccatat
aatgtcagtgacgatccctggctagttgcatacaacttcttgcagaaaaatgatttgaat
cccatgtttctggatcaggtggctaaatttattattgataacacaaaaggtcaaacactg
ggacttgggaataccagtttttcagatccgtttacaggtggtggtcgctatgttccagga
acttcaggaccttccaacacagtgcagacagcagatcctttcacaggtgctgggcgttac
atgccaggttctgcaggtatggacaccaccatgactggagttgatccatttacagggaac
agtgcctaccgatcagctgcatctaaaacagtgaacatttatttccccaaaaaagaagct
cttacctttgaccaagcaaaccctacacaaatattaggaaaactgaaggaacttaatgga
actgcacctgaagagaagaagctaactgaagacgacttagtacttcttgaaaagatactg
tccctgatttgtaataattcctcagaaaagccaacggcccagcaacttcagattttgtgg
aaagctatcaactggcctgaagacattgtctttcctgcacttgacattcttcgcctatcg
attaagcatcccaatgtgaatgagaatttctgcaatgaaaaaggagaccagttcagcagc
catcttatcaaccttctgaaccccaaaggaaagccagcaaaccagctgcttgctcttagg
actttttgcaattgctttgttagtcaggcaggacaaaagctcatgatgtcccagagggag
tcactgatgtcacatgcaatagaactgaaatccgggagtaataagaacattcatattgct
ctggctacattgaccttgaactattctgtttgtttccataaagaccataacattgaaggg
aaagctcaatgcctctcagtaattagcacaatcttggaagttgtgcaagacctagaagcc
acgtttagactccttgtggctcttgggacacttatcagtgatgattcaaatgctatacaa
ttagccaaatctttaggtgttgattctcaaataaaaaagtatgtctccgtatcagagcca
gctaaagtgagtgaatgctgtagacttgtcttacatttgctgtag

DBGET integrated database retrieval system