KEGG   Mus musculus (mouse): 18787
Entry
18787             CDS       T01002                                 

Gene name
Serpine1, P, PA, PAI-1, PAI1, Pl, Planh1
Definition
(RefSeq) serine (or cysteine) peptidase inhibitor, clade E, member 1
  KO
K03982  plasminogen activator inhibitor 1
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04066  HIF-1 signaling pathway
mmu04115  p53 signaling pathway
mmu04218  Cellular senescence
mmu04371  Apelin signaling pathway
mmu04390  Hippo signaling pathway
mmu04610  Complement and coagulation cascades
mmu04933  AGE-RAGE signaling pathway in diabetic complications
mmu05142  Chagas disease
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04390 Hippo signaling pathway
    18787 (Serpine1)
   04371 Apelin signaling pathway
    18787 (Serpine1)
   04066 HIF-1 signaling pathway
    18787 (Serpine1)
 09140 Cellular Processes
  09143 Cell growth and death
   04115 p53 signaling pathway
    18787 (Serpine1)
   04218 Cellular senescence
    18787 (Serpine1)
 09150 Organismal Systems
  09151 Immune system
   04610 Complement and coagulation cascades
    18787 (Serpine1)
 09160 Human Diseases
  09174 Infectious disease: parasitic
   05142 Chagas disease
    18787 (Serpine1)
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    18787 (Serpine1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:mmu01002]
    18787 (Serpine1)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:mmu04147]
    18787 (Serpine1)
   00536 Glycosaminoglycan binding proteins [BR:mmu00536]
    18787 (Serpine1)
Peptidases and inhibitors [BR:mmu01002]
 Peptidase inhibitors
  Family I4: serpin family
   18787 (Serpine1)
Exosome [BR:mmu04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   18787 (Serpine1)
Glycosaminoglycan binding proteins [BR:mmu00536]
 Heparan sulfate / Heparin
  Coagulation and fibrinolysis
   18787 (Serpine1)
SSDB
Motif
Pfam: Serpin
Other DBs
NCBI-GeneID: 18787
NCBI-ProteinID: NP_032897
MGI: 97608
Ensembl: ENSMUSG00000037411
Vega: OTTMUSG00000054456
UniProt: G5E899
Structure
PDB: 
3LW2

Position
5; 5 G2
AA seq 402 aa
MQMSSALACLILGLVLVSGKGFTLPLRESHTAHQATDFGVKVFQQVVQASKDRNVVFSPY
GVSSVLAMLQMTTAGKTRRQIQDAMGFKVNEKGTAHALRQLSKELMGPWNKNEISTADAI
FVQRDLELVQGFMPHFFKLFQTMVKQVDFSEVERARFIINDWVERHTKGMISDLLAKGAV
DELTRLVLVNALYFSGQWKTPFLEASTHQRLFHKSDGSTVSVPMMAQSNKFNYTEFTTPD
GLEYDVVELPYQGDTLSMFIAAPFEKDVHLSALTNILDAELIRQWKGNMTRLPRLLILPK
FSLETEVDLRGPLEKLGMPDMFSATLADFTSLSDQEQLSVAQALQKVRIEVNESGTVASS
STAFVISARMAPTEMVIDRSFLFVVRHNPTETILFMGQVMEP
NT seq 1209 nt   +upstreamnt  +downstreamnt
atgcagatgtcttcagcccttgcttgcctcatcctgggcctggttctggtctctgggaaa
gggttcactttacccctccgagaatcccacacagcccatcaggccaccgacttcggagta
aaagtgtttcagcaggtggtccaggcctccaaagaccggaatgtggtcttctctccctat
ggcgtgtcctcggtgctggctatgctgcagatgaccacagcggggaaaacccggcggcag
atccaagatgctatgggattcaaagtcaatgagaagggcacagctcatgccctccgccag
ctctccaaggagctcatggggccgtggaacaagaatgagatcagtactgcggatgccatc
tttgtccagcgggacctagagctggtccagggcttcatgccccacttcttcaagctcttc
cagactatggtgaaacaggtggacttctcagaagtggaaagagccagatttatcatcaat
gactgggtggaaaggcataccaaaggtatgatcagtgacttactggccaagggggctgta
gacgagctgacacgcctggtgctggtgaatgccctctacttcagtggccaatggaagact
cctttcttagaggccagcacccaccagcgcctcttccacaagtctgatggcagcaccgtc
tctgtgcccatgatggctcagagcaacaagttcaactacactgagttcaccacccccgat
gggctcgagtatgacgttgtggaactgccctaccagggcgacaccctcagcatgttcatc
gctgcaccctttgagaaagatgtgcacctctccgccctcaccaacatcttggatgctgaa
ctcatcagacaatggaagggcaacatgaccaggctgccccgcctcctcatcctgcctaag
ttctctctggagactgaagtggacctcagagggcccctggagaagttgggcatgcctgac
atgtttagtgcaaccctggccgacttcacaagtctttccgaccaagagcagctctctgta
gcacaggcactgcaaaaggtcaggatcgaggtaaacgagagcggcacagtggcgtcttcc
tccacagcctttgtcatctcagcccgcatggcccccacggagatggttatagaccgatcc
tttctctttgtggttcggcacaacccgacagagacaatcctcttcatgggccaagtgatg
gagccttga

DBGET integrated database retrieval system