KEGG   Mus musculus (mouse): 18789Help
Entry
18789             CDS       T01002                                 

Gene name
Papola, Pap, PapIII, Plap
Definition
(RefSeq) poly (A) polymerase alpha
  KO
K14376  poly(A) polymerase [EC:2.7.7.19]
Organism
mmu  Mus musculus (mouse)
Pathway
mmu03015  mRNA surveillance pathway
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09120 Genetic Information Processing
  09122 Translation
   03015 mRNA surveillance pathway
    18789 (Papola)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:mmu03019]
    18789 (Papola)
Enzymes [BR:mmu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.19  polynucleotide adenylyltransferase
     18789 (Papola)
Messenger RNA biogenesis [BR:mmu03019]
 Eukaryotic Type
  mRNA processing factors
   3' end processing
    Poly(A) addition factors
     18789 (Papola)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PAP_central PAP_RNA-bind NTP_transf_2 Polbeta
Motif
Other DBs
NCBI-GeneID: 18789
NCBI-ProteinID: NP_035242
MGI: 109301
Ensembl: ENSMUSG00000021111
Vega: OTTMUSG00000035482
UniProt: Q61183 Q3V141
Position
12; 12 E
AA seq 739 aa AA seqDB search
MPFPVTTQGSQQTQPPQRHYGITSPISLAAPKETDCLLTQKLIETLKPFGVFEEEEELQR
RILILGKLNNLVKEWIREISESKNLPQSVIENVGGKIFTFGSYRLGVHTKGADIDALCVA
PRHVDRSDFFTSFYDKLKLQEEVKDLRAVEEAFVPVIKLCFDGIEIDILFARLALQTIPE
DLDLRDDSLLKNLDIRCIRSLNGCRVTDEILHLVPNIDNFRLTLRAIKLWAKRHNIYSNI
LGFLGGVSWAMLVARTCQLYPNAIASTLVHKFFLVFSKWEWPNPVLLKQPEECNLNLPVW
DPRVNPSDRYHLMPIITPAYPQQNSTYNVSVSTRMVMVEEFKQGLAITDEILLSKAEWSK
LFEAPNFFQKYKHYIVLLASAPTEKQRLEWVGLVESKIRILVGSLEKNEFITLAHVNPQS
FPAPKESPDREEFRTMWVIGLVFKKTENSENLSVDLTYDIQSFTDTVYRQAINSKMFELD
MKIAAMHVKRKQLHQLLPSHVLQKRKKHSTEGVKLTALNDSSLDLSMDSDNSMSVPSPTS
AMKTSPLNSSGSSQGRNSPAPAVTAASVTSIQASEVSVPQANSSESPGGPSSESIPQTAT
QPAISPPPKPTVSRVVSSTRLVNPSPRPSGNTATKVPNPIVGVKRTSSPNKEESPKKTKT
EEDETSEDANCLALSGHDKTETKEQVDLETSAVQSETVPASASLLASQKTSSTDLSDIPA
LPANPIPVIKNSIKLRLNR
NT seq 2220 nt NT seq  +upstreamnt  +downstreamnt
atgccgtttccagttacaacgcagggatcacaacaaacgcagccaccacagaggcactat
ggcattacctctcctatcagcttagcggcccccaaggagactgactgcctactcacacag
aagctcatcgagacgctgaagccctttggggtttttgaagaagaagaggaactgcagcgc
aggattttaattttgggaaaattaaataacctggtgaaagaatggattcgagaaatcagt
gaaagcaagaatctcccacaatctgtaattgaaaatgttggagggaagatttttacattt
ggatcttacagactaggagtccacacgaaaggtgctgatattgatgcgttgtgtgttgca
ccaagacatgttgatcgaagtgactttttcacctcattctatgataaattgaaattacaa
gaagaagtgaaagatttaagagctgttgaagaggcatttgtaccagttatcaaactctgt
tttgatggaatagagattgatattttgtttgcaagattagcactgcagactattccagaa
gatttggacctacgagatgacagtctgcttaaaaacctagatataagatgcataagaagc
cttaatggttgcagggtaaccgatgaaattttacatctagtaccaaacattgacaacttc
aggttaactctgagagccatcaaactgtgggccaaacggcacaacatctattccaatata
ttaggtttcctcggtggtgtttcctgggctatgctagtagcaagaacttgccagctttat
ccaaatgcaatagcatcaactcttgtacataaatttttcttggtattttctaaatgggaa
tggccaaatccagtgctattgaaacagcctgaagaatgcaatcttaatttgcctgtgtgg
gacccaagggtaaaccccagtgataggtaccatcttatgcctataattacaccagcatac
ccacagcagaactccacgtacaatgtgtccgtttcaacacggatggtcatggttgaggag
tttaaacaaggtcttgctatcacagatgaaattttgctgagtaaggcagagtggtccaaa
ctttttgaagctccaaacttctttcagaagtacaagcattatattgtacttctagcaagt
gcgcccacggaaaagcagcgtctggaatgggtgggcttggtggaatcaaaaatccgcatc
ctggttggaagcttggagaagaatgagtttattacactggctcatgtgaatccccagtca
tttccagcccccaaagaaagtcctgacagggaagaatttcgcacaatgtgggtgattggg
ttagtgtttaaaaaaactgaaaactctgaaaatctcagtgtcgacctcacctatgatatc
cagtctttcacagacacagtttataggcaagcaataaacagcaaaatgtttgagttggat
atgaagattgcagcaatgcatgtgaagagaaagcaactccatcagctgctgcctagtcac
gtgcttcagaagaggaagaagcattcaacagaaggagtcaagttaacagctctgaatgac
agcagccttgacttgtctatggacagtgataacagcatgtctgtgccttcacccaccagt
gctatgaagaccagtccattgaatagttctggcagctcccagggcagaaacagtcctgct
ccagctgtgaccgcagcatctgtgaccagcatccaggcttctgaggtttctgtaccgcaa
gcaaattccagtgaaagcccagggggtccatcgagcgaaagcattcctcaaactgccaca
cagccagccatttctccaccaccaaagcctacagtctccagagttgtctcctcaacacga
ctggtaaacccatcgcctagaccttcaggaaacacagcaacaaaagtccctaatcctata
gtaggagtcaagagaacgtcctcacccaataaagaagaaagtcctaagaaaaccaaaaca
gaagaggatgaaacaagtgaagatgctaactgtcttgctttgagtggacatgataaaaca
gagacaaaggaacaagttgatctggagacaagtgcggttcaatcagaaactgttccggca
tcggcttctctgttggcctctcagaaaacatccagtacagacctttctgatatccctgct
ctccctgcaaatcctattcctgttatcaagaattcaataaaactgagactgaatcggtaa

DBGET integrated database retrieval system