KEGG   Mus musculus (mouse): 18791
Entry
18791             CDS       T01002                                 

Gene name
Plat, AU020998, AW212668, D8Ertd2e, tPA
Definition
(RefSeq) plasminogen activator, tissue
  KO
K01343  tissue plasminogen activator [EC:3.4.21.68]
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04371  Apelin signaling pathway
mmu04610  Complement and coagulation cascades
mmu05202  Transcriptional misregulation in cancer
mmu05215  Prostate cancer
mmu05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04371 Apelin signaling pathway
    18791 (Plat)
 09150 Organismal Systems
  09151 Immune system
   04610 Complement and coagulation cascades
    18791 (Plat)
 09160 Human Diseases
  09161 Cancer: overview
   05202 Transcriptional misregulation in cancer
    18791 (Plat)
  09162 Cancer: specific types
   05215 Prostate cancer
    18791 (Plat)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    18791 (Plat)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:mmu01002]
    18791 (Plat)
  09183 Protein families: signaling and cellular processes
   00536 Glycosaminoglycan binding proteins [BR:mmu00536]
    18791 (Plat)
Enzymes [BR:mmu01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.21  Serine endopeptidases
    3.4.21.68  t-plasminogen activator
     18791 (Plat)
Peptidases and inhibitors [BR:mmu01002]
 Serine peptidases
  Family S1: chymotrypsin family
   18791 (Plat)
Glycosaminoglycan binding proteins [BR:mmu00536]
 Heparan sulfate / Haparin
  Coagulation and fibrinolysis
   18791 (Plat)
SSDB
Motif
Pfam: Trypsin Kringle fn1 EGF DUF1986 Trypsin_2 hEGF EGF_2
Other DBs
NCBI-GeneID: 18791
NCBI-ProteinID: NP_032898
MGI: 97610
Ensembl: ENSMUSG00000031538
Vega: OTTMUSG00000060895
UniProt: P11214
Position
8 A2; 8 11.42 cM
AA seq 559 aa
MKRELLCVLLLCGLAFPLPDQGIHGRFRRGARSYRATCRDEPTQTTYQQHQSWLRPMLRS
SRVEYCRCNSGLVQCHSVPVRSCSEPRCFNGGTCQQALYFSDFVCQCPDGFVGKRCDIDT
RATCFEEQGITYRGTWSTAESGAECINWNSSVLSLKPYNARRPNAIKLGLGNHNYCRNPD
RDLKPWCYVFKAGKYTTEFCSTPACPKGKSEDCYVGKGVTYRGTHSLTTSQASCLPWNSI
VLMGKSYTAWRTNSQALGLGRHNYCRNPDGDARPWCHVMKDRKLTWEYCDMSPCSTCGLR
QYKRPQFRIKGGLYTDITSHPWQAAIFVKNKRSPGERFLCGGVLISSCWVLSAAHCFLER
FPPNHLKVVLGRTYRVVPGEEEQTFEIEKYIVHEEFDDDTYDNDIALLQLRSQSKQCAQE
SSSVGTACLPDPNLQLPDWTECELSGYGKHEASSPFFSDRLKEAHVRLYPSSRCTSQHLF
NKTVTNNMLCAGDTRSGGNQDLHDACQGDSGGPLVCMINKQMTLTGIISWGLGCGQKDVP
GVYTKVTNYLDWIHDNMKQ
NT seq 1680 nt   +upstreamnt  +downstreamnt
atgaagagagagctgctgtgtgtactgctgctttgtggactggctttcccattgcctgac
cagggaatacatgggaggttcagaagaggagcccggtcctacagagcgacctgcagagat
gagccaacgcagacaacttaccaacagcaccagtcgtggctccgacccatgctcagaagc
agccgggtggaatattgccggtgcaacagcggcctggtacaatgccactcagtgcctgtc
cgaagttgcagcgaaccaagatgcttcaatggggggacgtgtcagcaggccctgtatttc
tctgactttgtctgccagtgccctgatggatttgtagggaaacgctgtgacatagatacc
agagcaacatgctttgaggagcagggcatcacctacagaggcacgtggagcacagcagaa
agtggggctgagtgcatcaactggaatagcagtgttctgtcgctgaagccctacaatgca
aggaggccaaatgccatcaagctgggccttgggaatcacaattactgcagaaacccagac
cgagacttgaagccctggtgctatgtctttaaggcagggaagtataccacggagttctgt
agcacaccagcttgccctaagggaaaaagcgaggactgctatgttgggaaaggtgtgact
taccgtggcacccacagcctcaccacatcccaggcctcctgcctcccctggaattccata
gtcctcatgggcaagagttacacagcgtggaggaccaactcccaggcactcggcctgggc
agacacaattattgtcggaatccagatggtgatgccagaccttggtgccatgtgatgaag
gaccgaaagctgacgtgggaatactgtgacatgtccccatgctccacctgtggcctgagg
cagtacaaacggcctcagtttagaattaaaggaggactctacacagacatcacctcacac
ccttggcaggctgccatctttgtcaagaacaagaggtctcctggagagagattcctttgt
ggaggggtgctgatcagttcctgctgggtgctgtcagctgcccactgctttctagagagg
ttcccccccaatcatcttaaagtggtcttgggcagaacatacagggtggtccccggagag
gaagaacagacatttgagattgaaaaatacatagtccatgaggaatttgatgacgatact
tatgacaacgacatcgcattactgcagctgaggtcacagtccaagcaatgtgcccaagag
agcagctctgttggcactgcctgcctccctgaccccaacctgcagctccctgactggaca
gagtgtgagctttctggctacggcaagcatgaggcatcgtctccattcttctctgaccgg
ctgaaggaggctcacgtcagactgtacccgtccagccgctgcacctcacagcatctgttt
aataaaaccgtcacgaacaacatgctgtgcgctggagacacccggagcggaggcaaccaa
gacctccacgatgcatgccagggtgactcgggaggccctctggtgtgcatgatcaataaa
cagatgacattgactggcattatcagctggggcctcggctgtgggcagaaggatgtgcct
ggggtctacacaaaggttacgaattacctagactggattcacgacaacatgaagcaatga

DBGET integrated database retrieval system