KEGG   Mus musculus (mouse): 18793
Entry
18793             CDS       T01002                                 

Gene name
Plaur, Cd87, u, u-, u-PAR, uPAR
Definition
(RefSeq) plasminogen activator, urokinase receptor
  KO
K03985  plasminogen activator, urokinase receptor
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04610  Complement and coagulation cascades
mmu05205  Proteoglycans in cancer
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09150 Organismal Systems
  09151 Immune system
   04610 Complement and coagulation cascades
    18793 (Plaur)
 09160 Human Diseases
  09161 Cancer: overview
   05205 Proteoglycans in cancer
    18793 (Plaur)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04090 CD molecules [BR:mmu04090]
    18793 (Plaur)
   00537 Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:mmu00537]
    18793 (Plaur)
CD molecules [BR:mmu04090]
 Proteins
  18793 (Plaur)
Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:mmu00537]
 Receptors
  18793 (Plaur)
SSDB
Motif
Pfam: UPAR_LY6 UPAR_LY6_2
Other DBs
NCBI-GeneID: 18793
NCBI-ProteinID: NP_035243
MGI: 97612
Ensembl: ENSMUSG00000046223
Vega: OTTMUSG00000058079
UniProt: P35456 Q545X5
Structure
PDB: 
6AEX 3LAQ

Position
7; 7 A3
AA seq 327 aa
MGLPRRLLLLLLLATTCVPASQGLQCMQCESNQSCLVEECALGQDLCRTTVLREWQDDRE
LEVVTRGCAHSEKTNRTMSYRMGSMIISLTETVCATNLCNRPRPGARGRAFPQGRYLECA
SCTSLDQSCERGREQSLQCRYPTEHCIEVVTLQSTERSLKDEDYTRGCGSLPGCPGTAGF
HSNQTFHFLKCCNYTHCNGGPVLDLQSFPPNGFQCYSCEGNNTLGCSSEEASLINCRGPM
NQCLVATGLDVLGNRSYTVRGCATASWCQGSHVADSFPTHLNVSVSCCHGSGCNSPTGGA
PRPGPAQLSLIASLLLTLGLWGVLLWT
NT seq 984 nt   +upstreamnt  +downstreamnt
atgggactcccaaggcggctgctgctgctgctgttgctggcgactacctgtgtcccagcc
tcccagggcctgcagtgcatgcagtgtgagagtaaccagagctgcctggtagaggagtgt
gctctgggccaggacctctgcaggactaccgtgcttcgggaatggcaagatgatagagag
ctggaggtggtgacaagaggctgtgcccacagcgaaaagaccaacaggaccatgagttac
cgcatgggctccatgatcatcagcctgacagagaccgtgtgcgccacaaacctctgcaac
aggcccagacccggagcccgaggccgtgctttcccccagggccgttacctcgagtgtgcg
tcctgcacctctttggaccagagctgtgagaggggccgggagcaaagcctgcaatgccgc
tatcctacagagcactgtattgaagtggtgaccctccagagcacagaaaggagcttgaag
gatgaggactacacccgaggctgtggcagtcttcccggatgcccaggcacagcaggtttc
catagcaaccagacctttcacttcctgaagtgttgcaactacacccactgcaatggtggc
ccagttctggatcttcagagctttccaccgaatggcttccagtgttacagctgtgagggg
aacaatacccttgggtgttcctccgaagaggcgtctctcatcaactgccggggaccaatg
aatcagtgcctggtggctacaggcttagatgtgctgggaaaccggagttataccgtaaga
ggctgcgccacggcttcctggtgccaaggctcccacgtggcagactccttcccgacccac
ctcaacgtctctgtctcctgctgccacggcagcggctgtaacagccccacagggggcgcc
cccaggccaggccctgctcaactcagcctcattgcctctctgctcctgaccctcggacta
tggggcgtcctcctctggacctga

DBGET integrated database retrieval system