KEGG   Mus musculus (mouse): 18799
Entry
18799             CDS       T01002                                 

Symbol
Plcd1, AW212592, C79986
Name
(RefSeq) phospholipase C, delta 1
  KO
K05857  phosphatidylinositol phospholipase C, delta [EC:3.1.4.11]
Organism
mmu  Mus musculus (mouse)
Pathway
mmu00562  Inositol phosphate metabolism
mmu01100  Metabolic pathways
mmu04020  Calcium signaling pathway
mmu04070  Phosphatidylinositol signaling system
mmu04919  Thyroid hormone signaling pathway
mmu04933  AGE-RAGE signaling pathway in diabetic complications
Module
mmu_M00130  Inositol phosphate metabolism, PI=> PIP2 => Ins(1,4,5)P3 => Ins(1,3,4,5)P4
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    18799 (Plcd1)
 09130 Environmental Information Processing
  09132 Signal transduction
   04020 Calcium signaling pathway
    18799 (Plcd1)
   04070 Phosphatidylinositol signaling system
    18799 (Plcd1)
 09150 Organismal Systems
  09152 Endocrine system
   04919 Thyroid hormone signaling pathway
    18799 (Plcd1)
 09160 Human Diseases
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    18799 (Plcd1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:mmu04131]
    18799 (Plcd1)
Enzymes [BR:mmu01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.4  Phosphoric-diester hydrolases
    3.1.4.11  phosphoinositide phospholipase C
     18799 (Plcd1)
Membrane trafficking [BR:mmu04131]
 Exocytosis
  Calcium ion-dependent exocytosis
   Phospholipases
    18799 (Plcd1)
 Endocytosis
  Macropinocytosis
   Phospholipase C
    18799 (Plcd1)
SSDB
Motif
Pfam: PI-PLC-X PI-PLC-Y EF-hand_like EF-hand_10 C2 PH_12 PH EF-hand_7 EF-hand_6 EF-hand_1 REV1_C Tail_P2_I TEP1_N
Other DBs
NCBI-GeneID: 18799
NCBI-ProteinID: NP_062650
MGI: 97614
Ensembl: ENSMUSG00000010660
Vega: OTTMUSG00000062974
UniProt: Q8R3B1
Position
9; 9 F3
AA seq 756 aa
MDSGRDFLTLHGLQDDPDLQALLKGSQLLKVKSSSWRRERFYKLQEDCKTIWQESRKVMR
SPESQLFSIEDIQEVRMGHRTEGLEKFARDIPEDRCFSIVFKDQRNTLDLIAPSPADVQH
WVQGLRKIIDRSGSMDQRQKLQHWIHSCLRKADKNKDNKMNFKEVKDFLKELNVQVDDSY
ARKIFRECDHSQTDSLEDEEIETFYRMLTQRAEIDRAFAEAAGSAETLSVEKLVTFLQHQ
QREEEAGPALALSLIERYEPSETAKAQRQMTKDGFLMYLLSADGNAFSLAHRRVYQDMNQ
PLSHYLVSSSHNTYLLEDQLTGPSSTEAYIRALCKGCRCLELDCWDGPNQEPIIYHGYTF
TSKILFCDVLRAIRDYAFKASPYPVILSLENHCSLEQQRVMAHHLRAILGPMLLDQPLDG
VTTSLPSPEQLKEKILLKGKKLGGLLPAGGENGPEATDVSDEDEAAEMEDEAVRSQVQHK
PKEDKLKLVPELSDMVIYCKSVHFGGFSSPSTSGQAFYEMASFSESRALRLLQESGNSFV
RHNVGHLSRIYPAGWRTDSSNYSPVEMWNGGCQIVALNFQTPGPEMDVYLGCFQDNGGCG
YVLKPAFLRDPDTTFNSRALTQGPWWAPKKLRVWIISGQQLPKVNKNKNSIVDPKVIVEI
HGVGQDVASRQTAVITNNGFNPRWDTEFEFVVAVPDLALVRFMVEDYDSSSKNDFIGQST
IPWNSLKQGYRHVHLLSKNGDLHPSATLFVKISIQD
NT seq 2271 nt   +upstreamnt  +downstreamnt
atggactccggtcgggacttcctgaccttgcacgggctgcaggatgacccggaccttcag
gccctcctgaagggcagccagcttctgaaggtgaagtccagctcgtggcgtagagaacgc
ttctacaagctacaggaggactgcaagaccatctggcaggaatctcgcaaggtcatgagg
tccccggagtcgcagctgttctccatcgaggacattcaggaggtgcggatgggacaccgc
acagaaggcctggagaaatttgccagagacatacccgaggaccgatgcttctccatcgtc
ttcaaggaccagcgcaataccctagacctcatcgccccgtctccagctgacgtccagcat
tgggtgcagggcctgcgcaagatcatcgaccgctcgggctccatggaccagcggcagaag
ctgcagcactggattcactcctgcttgcgaaaggctgataaaaacaaggataacaagatg
aacttcaaggaggtgaaggacttcctgaaggagctcaacgtacaggtggatgacagctac
gccaggaagatcttcagggaatgtgaccactcccagacagactcgctggaggatgaggag
attgagaccttctacaggatgctgacccagcgggcagagatcgaccgtgcctttgcagag
gccgcaggttctgcggagaccctgtcggtggagaagctagtgacgttcctgcagcatcag
cagcgggaggaggaggcggggccagccttggccctctctctcattgagcgctacgagccc
agtgagactgccaaagcccagcggcagatgaccaaggatggcttcctcatgtacctgctg
tctgctgacggtaacgccttcagcctggcgcaccgccgtgtctaccaggacatgaaccag
ccgctcagccactacttagtgtcttcttcccacaacacctacctactggaggaccagctc
acagggcccagcagcacggaggcctacatccgggctctgtgcaaaggctgccggtgtctg
gagctggactgctgggacggccccaaccaggaacccatcatctaccatggctacactttt
acctctaagatacttttctgcgacgtgctcagggccatccgggactacgccttcaaggca
tccccctacccagttatcctgtccctggagaaccactgcagcctggagcaacaacgagtc
atggctcatcacctgagggccatcctggggcccatgctgttggaccagccgctggatggg
gttaccacgagcctgccttcgcctgagcaactgaaggaaaagattctgttgaaagggaag
aaactgggcgggctgctacctgctggaggggaaaacgggcctgaagccaccgatgtgtct
gacgaagatgaggctgctgaaatggaagatgaggccgtgcgcagccaagtgcaacacaag
cccaaggaggataagctaaagctggtgccggagctctccgacatggtcatttactgcaag
agtgtccactttggtggcttctccagtcctagcacctctgggcaggcattctatgagatg
gcttccttctccgagagccgtgccctgcggctgctgcaagaatcaggaaatagttttgtc
cgccataacgtgggccatctgagcaggatctacccagctgggtggaggacagattcctcc
aactacagtcccgtggagatgtggaatggaggctgccagattgtggctctgaacttccaa
acccctgggccagaaatggatgtttaccttggctgcttccaggacaatggaggttgtggg
tatgtgctgaaaccggccttcctgagagaccctgacaccaccttcaactcacgggccctg
actcaggggccctggtgggccccgaagaagctccgagtctggatcatctctggacagcag
ctgccgaaggtcaataagaataagaattctatcgtggaccccaaggtgatagtggagatc
cacggtgtgggccaggatgtggccagccgtcagacagcagttattaccaataatggtttc
aacccacggtgggacacggagtttgagtttgtggtagcagtgcctgaccttgcccttgta
cgtttcatggtagaggattatgactcctcctctaagaacgactttatcggccagagtact
atcccctggaacagcctcaagcaggggtaccgccatgtccacctcttgtctaagaatgga
gacctgcatccatcagccactctctttgtgaagatctccatccaggactaa

DBGET integrated database retrieval system