KEGG   Mus musculus (mouse): 18806
Entry
18806             CDS       T01002                                 

Symbol
Pld2, PLD1C
Name
(RefSeq) phospholipase D2
  KO
K01115  phospholipase D1/2 [EC:3.1.4.4]
Organism
mmu  Mus musculus (mouse)
Pathway
mmu00564  Glycerophospholipid metabolism
mmu00565  Ether lipid metabolism
mmu01100  Metabolic pathways
mmu04014  Ras signaling pathway
mmu04024  cAMP signaling pathway
mmu04071  Sphingolipid signaling pathway
mmu04072  Phospholipase D signaling pathway
mmu04144  Endocytosis
mmu04666  Fc gamma R-mediated phagocytosis
mmu04724  Glutamatergic synapse
mmu04912  GnRH signaling pathway
mmu04928  Parathyroid hormone synthesis, secretion and action
mmu05200  Pathways in cancer
mmu05208  Chemical carcinogenesis - reactive oxygen species
mmu05212  Pancreatic cancer
mmu05231  Choline metabolism in cancer
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    18806 (Pld2)
   00565 Ether lipid metabolism
    18806 (Pld2)
 09130 Environmental Information Processing
  09132 Signal transduction
   04014 Ras signaling pathway
    18806 (Pld2)
   04072 Phospholipase D signaling pathway
    18806 (Pld2)
   04071 Sphingolipid signaling pathway
    18806 (Pld2)
   04024 cAMP signaling pathway
    18806 (Pld2)
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    18806 (Pld2)
 09150 Organismal Systems
  09151 Immune system
   04666 Fc gamma R-mediated phagocytosis
    18806 (Pld2)
  09152 Endocrine system
   04912 GnRH signaling pathway
    18806 (Pld2)
   04928 Parathyroid hormone synthesis, secretion and action
    18806 (Pld2)
  09156 Nervous system
   04724 Glutamatergic synapse
    18806 (Pld2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    18806 (Pld2)
   05208 Chemical carcinogenesis - reactive oxygen species
    18806 (Pld2)
   05231 Choline metabolism in cancer
    18806 (Pld2)
  09162 Cancer: specific types
   05212 Pancreatic cancer
    18806 (Pld2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:mmu04131]
    18806 (Pld2)
Enzymes [BR:mmu01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.4  Phosphoric-diester hydrolases
    3.1.4.4  phospholipase D
     18806 (Pld2)
Membrane trafficking [BR:mmu04131]
 Exocytosis
  Calcium ion-dependent exocytosis
   Phospholipases
    18806 (Pld2)
 Endosome - Golgi transport
  Others
   Others
    18806 (Pld2)
SSDB
Motif
Pfam: PX PLDc_2 PLDc PH PH_2
Other DBs
NCBI-GeneID: 18806
NCBI-ProteinID: NP_032902
MGI: 892877
Ensembl: ENSMUSG00000020828
Vega: OTTMUSG00000006051
UniProt: P97813 Q5SXG5 Q3UNY4
Position
11 B3; 11 42.99 cM
AA seq 933 aa
MTVTQKNLFPYGDYLNSSQLHMEPDEVDTLREGEDPADRMHPYLAIYDLQPLKAHPLVFA
PGVPVIAQVVGTERYTSGSKVGTCTLYSVRLTHGDFTWTTKKKFRHFQELHRDLQRHKVL
MSLLPLARFAVTHSPAREAAAEDIPSLPRGGSEGSARHTASKQKYLENYLNRLLTMSFYR
NYHAMTEFLEVSQLSFIPDLGSKGLEGVIRKRSGGHRVPGFTFCGRDQVCYRWSKRWLVV
KDSFLLYMRPETGAISFVQLFDPGFEVQVGKRSTETRYGVRIDTSHRSLILKCSSYRQAR
WWGQEITELAQGSGRDFLQLHQHDSYAPPRPGTLARWFVNGAGYFAAVADAILRAQEEIF
ITDWWLSPEIYLKRPAHSDDWRLDIMLKRKAEEGVRVSILLFKEVELALGINSGYSKRTL
MLLHPNIKVMRHPDLVTLWAHHEKLLVVDQVVAFLGGLDLAFGRWDDVQYRLTDLGDPSE
PVHLQTPTLGSDPAATPDLSHNQFFWLGKDYSNLITKDWVQLDRPFEDFIDRETTPRMPW
RDVGVVVHGVAARDLARHFIQRWNFTKTTKARYKTPLYPYLLPKSTSTANNLPFMIPGGQ
CATVQVLRSVDRWSAGTLENSILNAYLHTIRESQHFLYIENQFFISCSDGRTVLNKVGDE
IVDRILKAHEQGQCFRVYLLLPLLPGFEGDISTGGGNSIQAILHFTYRTLCRGEHSILHR
LKAAMGTAWRDYMSICGLRTHGELGGHPISELIYIHSKMLIADDRTVIIGSANINDRSLL
GKRDSELAILIKDTEMEPSLMDGVEYQAGRFALSLRKHCFSVILGANTWPDLDLRDPVCD
DFFQLWQETAENNATIYEQIFRCLPSNATRSLRALREYVAVESLATVSPSLAQSELAHIQ
GHLVHFPLKFLEDESLLPPLGSKEGMIPLEVWT
NT seq 2802 nt   +upstreamnt  +downstreamnt
atgactgtaacccagaagaacctctttccctatggggactatctgaactccagccagttg
cacatggagccagatgaggttgacactctgagggaaggagaggatccagctgatcgaatg
catccctatctggccatctatgaccttcagcctctgaaagcacaccccttggtgttcgcc
cctggggtccctgttatagcccaggtggtgggcaccgaaagatacaccagcggatccaag
gtgggaacctgtactctatattctgttcgcttgacgcatggtgactttacctggacaacc
aagaagaagttccgacactttcaggagctgcatcgggacctccagagacacaaagtcttg
atgagtctgctccctttggctcgctttgctgtgacccattctccagcccgagaggcagcc
gccgaggatataccctccctaccccgaggaggttctgagggctctgccagacacacagcc
agcaaacagaaatacttggaaaattacctcaaccgcctcctgaccatgtctttctatcgc
aattaccacgccatgacagaatttctggaagtcagtcaactttcctttatcccagacctt
ggctccaaaggactggaaggggtgatccggaagcgctcgggcgggcatcgagttcccggc
ttcaccttctgtggccgagaccaagtttgttatcgatggtccaagaggtggctggtggtg
aaggactccttcctgctgtacatgcgcccggagaccggcgccatctcatttgttcagctt
tttgaccctggctttgaggtccaggtcggaaaaaggagcacagagacgcggtatggggtg
aggatcgacacctcccacaggtccctgattctcaaatgcagcagctaccggcaggcacgg
tggtggggccaggagatcacggagctggcacagggttcgggcagagattttctacagcta
catcagcatgacagctatgccccaccccggcccggcaccctggcccggtggtttgtgaat
ggggcaggttactttgctgctgtggcagatgccatcctgcgagctcaagaggagattttc
atcacagactggtggttgagtcctgaaatttacctgaagcgtccagcccattccgacgac
tggagactggacattatgctcaagaggaaggcggaagaaggtgtccgagtttccatactg
ctgtttaaggaagtggagctggccttgggcatcaacagtggctacagcaagaggacgctg
atgctgctgcatcccaacataaaggtgatgcgacacccagaccttgtgacactgtgggct
catcacgagaagctcctggtggtagaccaagtggtggcattcttgggcgggctggacctg
gccttcggccgctgggatgacgtgcaataccgactgactgacctgggtgacccctctgaa
cctgtacatttacagactcccacactaggttcagaccctgcagccactccagacctctcg
cataaccaattcttctggctgggaaaggactacagcaacctcatcaccaaggactgggtg
cagctggaccggccttttgaagatttcatcgacagggagaccacacccaggatgccatgg
agggatgttggagtggttgtacacggagtagctgccagggaccttgcccggcacttcatc
cagcgctggaatttcaccaagaccaccaaggccaggtataagacacctttgtacccctac
ctgctgcccaagtccaccagcactgcaaacaatctccccttcatgatcccaggcgggcag
tgtgccactgtgcaggtcttgaggtctgtggatcgatggtcagcagggacattggagaac
tccatcctcaatgcctacctacataccattcgagagagccagcactttctctacattgag
aatcagttcttcattagctgctcagatgggcgaacagttctgaacaaggtgggcgatgag
attgtggacagaatcctgaaggctcacgaacaggggcagtgtttccgagtctacttgctt
ctgcctttgctccctggctttgagggggacatctccacagggggtggtaactccatccag
gctattctgcacttcacctacaggaccctgtgtcgtggggaacattcaatcctacatcgt
ctcaaagcagccatggggactgcgtggcgagattacatgtccatctgtgggcttcgcacc
catggagagctgggcgggcacccaatctctgagctcatctatatccacagcaagatgctc
attgcggatgacagaacagtcatcattggttctgcgaacatcaatgacaggagcttgctg
gggaagcgtgacagtgagctagccatcctgatcaaggacacagaaatggaaccatccctc
atggatggggtggagtaccaggcaggcagatttgccttgagtttgcggaagcactgtttc
agtgtgattcttggggcaaatacctggccagacctggatctccgagaccctgtctgtgat
gacttcttccagctgtggcaagaaacagcggagaacaatgccaccatctatgagcagatc
ttccgctgcctgccgtccaatgctacccgttccctgcgggctctccgggagtatgtggct
gtggagtccttggctacagtcagcccttctttggctcagtctgagcttgcccacatccag
ggccacctagttcacttccccctcaagtttctggaggacgagtccttgttgcccccactg
gggagtaaagaagggatgatacctttagaagtgtggacatag

DBGET integrated database retrieval system