KEGG   Mus musculus (mouse): 18810
Entry
18810             CDS       T01002                                 

Gene name
Plec, AA591047, AU042537, EBS1, PCN, PLTN, Plec1
Definition
(RefSeq) plectin
  KO
K10388  plectin
Organism
mmu  Mus musculus (mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:mmu04812]
    18810 (Plec)
Cytoskeleton proteins [BR:mmu04812]
 Eukaryotic cytoskeleton proteins
  Intermediate filaments
   Intermediate filament-binding proteins
    18810 (Plec)
SSDB
Motif
Pfam: Plectin CH S10_plectin Spectrin_like SH3_10 CAMSAP_CH
Other DBs
NCBI-GeneID: 18810
NCBI-ProteinID: NP_001157012
MGI: 1277961
Ensembl: ENSMUSG00000022565
Vega: OTTMUSG00000035240
UniProt: Q9QXS1
Structure
PDB: 
4Q57 1SH5 1SH6

Position
15 D3; 15 35.48 cM
AA seq 4691 aa
MVAGMLMPLDRLRAIYEVLFREGVMVAKKDRRPRSLHPHVPGVTNLQVMRAMASLKARGL
VRETFAWCHFYWYLTNEGIDHLRQYLHLPPEIVPASLQRVRRPVAMVIPARRRSPHVQTM
QGPLGCPPKRGPLPAEDPAREERQVYRRKEREEGAPETPVVSATTVGTLARPGPEPAPAT
DERDRVQKKTFTKWVNKHLIKHWRAEAQRHISDLYEDLRDGHNLISLLEVLSGDSLPREK
GRMRFHKLQNVQIALDYLRHRQVKLVNIRNDDIADGNPKLTLGLIWTIILHFQISDIQVS
GQSEDMTAKEKLLLWSQRMVEGYQGLRCDNFTTSWRDGRLFNAIIHRHKPMLIDMNKVYR
QTNLENLDQAFSVAERDLGVTRLLDPEDVDVPQPDEKSIITYVSSLYDAMPRVPGAQDGV
RANELQLRWQEYRELVLLLLQWIRHHTAAFEERKFPSSFEEIEILWCQFLKFKETELPAK
EADKNRSKVIYQSLEGAVQAGQLKIPPGYHPLDVEKEWGKLHVAILEREKQLRSEFERLE
CLQRIVSKLQMEAGLCEEQLNQADALLQSDIRLLASGKVAQRAGEVERDLDKADGMIRLL
FNDVQTLKDGRHPQGEQMYRRVYRLHERLVAIRTEYNLRLKAGVGAPVTQVTLQSTQRRP
ELEDSTLRYLQDLLAWVEENQRRIDSAEWGVDLPSVEAQLGSHRGMHQSIEEFRAKIERA
RNDESQLSPATRGAYRDCLGRLDLQYAKLLNSSKARLRSLESLHGFVAAATKELMWLNEK
EEEEVGFDWSDRNTNMAAKKESYSALMRELEMKEKKIKEIQNTGDRLLREDHPARPTVES
FQAALQTQWSWMLQLCCCIEAHLKENTAYFQFFSDVREAEEQLQKLQETLRRKYSCDRTI
TVTRLEDLLQDAQDEKEQLNEYKGHLSGLAKRAKAIVQLKPRNPAHPVRGHVPLIAVCDY
KQVEVTVHKGDQCQLVGPAQPSHWKVLSGSSSEAAVPSVCFLVPPPNQEAQEAVARLEAQ
HQALVTLWHQLHVDMKSLLAWQSLSRDIQLIRSWSLVTFRTLKPEEQRQALRNLELHYQA
FLRDSQDAGGFGPEDRLVAEREYGSCSRHYQQLLQSLEQGEQEESRCQRCISELKDIRLQ
LEACETRTVHRLRLPLDKDPARECAQRIAEQQKAQAEVEGLGKGVARLSAEAEKVLALPE
PSPAAPTLRSELELTLGKLEQVRSLSAIYLEKLKTISLVIRSTQGAEEVLKTHEEQLKEA
QAVPATLQELEATKASLKKLRAQAEAQQPVFNTLRDELRGAQEVGERLQQRHGERDVEVE
RWRERVTQLLERWQAVLAQTDVRQRELEQLGRQLRYYRESADPLSAWLQDAKRRQEQIQA
VPIANCQAAREQLRQEKALLEEIERHGEKVEECQKFAKQYINAIKDYELQLITYKAQLEP
VASPAKKPKVQSGSESVIQEYVDLRTRYSELTTLTSQYIKFISETLRRMEEEERLAEQQR
AEERERLAEVEAALEKQRQLAEAHAQAKAQAELEAQELQRRMQEEVARREEAAVDAQQQK
RSIQEELQHLRQSSEAEIQAKAQQVEAAERSRMRIEEEIRVVRLQLETTERQRGGAEGEL
QALRARAEEAEAQKRQAQEEAERLRRQVQDESQRKRQAEAELALRVKAEAEAAREKQRAL
QALDELRLQAEEAERRLRQAEAERARQVQVALETAQRSAEVELQSKRASFAEKTAQLERT
LQEEHVTVAQLREEAERRAQQQAEAERAREEAERELERWQLKANEALRLRLQAEEVAQQK
SLAQADAEKQKEEAEREARRRGKAEEQAVRQRELAEQELEKQRQLAEGTAQQRLAAEQEL
IRLRAETEQGEQQRQLLEEELARLQHEATAATQKRQELEAELAKVRAEMEVLLASKARAE
EESRSTSEKSKQRLEAEAGRFRELAEEAARLRALAEEAKRQRQLAEEDAARQRAEAERVL
TEKLAAISEATRLKTEAEIALKEKEAENERLRRLAEDEAFQRRRLEEQAALHKADIEERL
AQLRKASESELERQKGLVEDTLRQRRQVEEEIMALKVSFEKAAAGKAELELELGRIRSNA
EDTMRSKEQAELEAARQRQLAAEEEQRRREAEERVQRSLAAEEEAARQRKVALEEVERLK
AKVEEARRLRERAEQESARQLQLAQEAAQKRLQAEEKAHAFVVQQREEELQQTLQQEQNM
LDRLRSEAEAARRAAEEAEEAREQAEREAAQSRKQVEEAERLKQSAEEQAQAQAQAQAAA
EKLRKEAEQEAARRAQAEQAALKQKQAADAEMEKHKKFAEQTLRQKAQVEQELTTLRLQL
EETDHQKSILDEELQRLKAEVTEAARQRSQVEEELFSVRVQMEELGKLKARIEAENRALI
LRDKDNTQRFLEEEAEKMKQVAEEAARLSVAAQEAARLRQLAEEDLAQQRALAEKMLKEK
MQAVQEATRLKAEAELLQQQKELAQEQARRLQEDKEQMAQQLVEETQGFQRTLEAERQRQ
LEMSAEAERLKLRMAEMSRAQARAEEDAQRFRKQAEEIGEKLHRTELATQEKVTLVQTLE
IQRQQSDHDAERLREAIAELEREKEKLKQEAKLLQLKSEEMQTVQQEQILQETQALQKSF
LSEKDSLLQRERFIEQEKAKLEQLFQDEVAKAKQLREEQQRQQQQMEQEKQELMASMEEA
RRRQREAEEGVRRKQEELQHLEQQRQQQEKLLAEENQRLRERLQRLEEEHRAALAHSEIA
TTQAASTKALPNGRDAPDGPSVEAEPEYTFEGLRQKVPAQQLQEAGILSQEELQRLAQGH
TTVAELTQREDVYRYLKGRSSIAGLLLKPTNEKLSVYTALQRQLLSPGTALILLEAQAAS
GFLLDPVRNRRLTVNEAVKEGVVGPELHHKLLSAERAVTGYKDPYTGEQISLFQAMKKDL
IVRDHGVRLLEAQIATGGIIDPVHSHRVPVDVAYKRGYFDEEMNRILSDPSDDTKGFFDP
NTHENLTYLQLLERCVEDPETGLRLLPLTDKAAKGGELVYTDTEARDVFEKATVSAPFGK
FQGRTVTIWEIINSEYFTAEQRRDLLQQFRTGHITVEKIIKIVITVVEEHERKGQLCFEG
LRALVPAAELLDSGVISHELYQQLQRGERSVREVAEADSVRQALRGTNVIAGVWLEEAGQ
KLSIYEALKKDLLQPEVAVALLEAQAGTGHIIDPATSARLTVDEAVRAGLVGPELHEKLL
SAEKAVTGYRDPYSGQSVSLFQALKKGLIPREQGLRLLDAQLSTGGIVDPSKSHRVPLDV
AYARGYLDKETNRALTSPRDDARVYHDPSTQEPVTYSQLQQRCRSDQLTGLSLLPLSEKA
VRARQEEVYSELQARETLEQAKVEVPVGSFKGRAMTVWELISSEYFTEEQRQELLRQFRT
GKVTVEKVIKIVITIVEEVETRRQERLSFSGLRAPVPASELLDAKILSRAQFDQLKDGKT
SVKELSEVGSVRTLLQGSGCLAGIYLEDSKEKVTIYEAMRRGLLRPSTATLLLEAQAATG
FLVDPVRNQRLYVHEAVKAGVVGPELHEKLLSAEKAVTGYKDPYSGNTISLFQAMKKGLV
LRDHAIRLLEAQVATGGIIDPVHSHRLPVDVAYQRGYFDEEMNRVLADPSDDTKGFFDPN
THENLTYLQLLERCVEDPETGLRLLPLKGAEKTEVVETTQVYTEEETRRAFEETQIDIPG
GGSHGGSSMSLWEVMQSNMIPEDQRARLMADFQAGRVTKERMIIIIIEIIEKTEIIRQQN
LASYDYVRRRLTAEDLYEARIISLETYNLFREGTKNLREVLEMESAWRYLYGTGAVAGVY
LPGSRQTLTIYQALKKGLLSAEVARLLLEAQAATGFLLDPVKGERLTVDEAVRKGLVGPE
LHDRLLSAERAVTGYRDPYTEQTISLFQAMKKELIPAEEALRLLDAQLATGGIVDPRLGF
HLPLEVAYQRGYLNKDTHDQLSEPSEVRSYVDPSTDERLSYTQLLKRCRRDDPSGQMLLL
LSDARKLTFRGLRKQITVEELVRSQVMDEATALQLQEGLTSIEEVTKNLQKFLEGTSCIA
GVFVDATKERLSVYQAMKKGIIRPGTAFELLEAQAATGYVIDPIKGLKLTVEEAVRMGIV
GPEFKDKLLSAERAVTGYKDPYSGKLISLFQAMKKGLILKDHGIRLLEAQIATGGIIDPE
ESHRLPVEVAYKRGLFDEEMNEILTDPSDDTKGFFDPNTEENLTYLQLMERCITDPQTGL
CLLPLKEKKRERKTSSKSSVRKRRVVIVDPETGKEMSVYEAYRKGLIDHQTYLELSEQEC
EWEEITISSSDGVVKSMIIDRRSGRQYDIDDAITKNLIDRSALDQYRAGTLSITEFADML
SGNAGGFRSRSSSVGSSSSYPISSAGPRTQLASWSDPTEETGPVAGILDTETLEKVSITE
AMHRNLVDNITGQRLLEAQACTGGIIDPSTGERFPVTEAVNKGLVDKIMVDRINLAQKAF
CGFEDPRTKTKMSAAQALKKGWLYYEAGQRFLEVQYLTGGLIEPDTPGRVSLDEALQRGT
VDARTAQKLRDVSAYSKYLTCPKTKLKISYKDALDRSMVEEGTGLRLLEAAAQSSKGYYS
PYSVSGSGSTAGSRTGSRTGSRAGSRRGSFDATGSGFSMTFSSSSYSSSGYGRRYASGPS
ASLGGPESAVA
NT seq 14076 nt   +upstreamnt  +downstreamnt
atggtggctggcatgctcatgccgctggaccggctacgggccatctatgaggtgctcttc
cgtgagggggtgatggttgccaagaaggaccggcgaccccgcagcctgcatccccatgtg
cccggcgtcaccaatctacaggtcatgcgtgccatggcttcactgaaagctcggggcctg
gtgcgggagacctttgcctggtgccacttctactggtacctgaccaacgagggcattgac
cacctacgccagtacttacacctgccaccggagattgtacctgcctctctgcagcgtgtg
cgccgccctgtcgccatggtgatacctgcacgtcgtcgctccccccatgtgcagaccatg
caaggtcccctaggctgcccaccaaagagggggcctctgccagctgaggaccctgcccgt
gaggagcggcaggtctatcgcaggaaggagcgtgaggagggggcacctgaaacccctgtg
gtgtctgccaccaccgtggggaccctggccagaccaggtccggagcctgccccagccaca
gatgaacgagaccgtgtgcagaagaaaactttcaccaagtgggtcaacaaacaccttatc
aagcactggagggcagaggctcagaggcacatcagtgacctgtacgaagacctccgtgat
ggccacaacctcatctccctgctggaagtcctctcaggagacagcctgccccgcgagaaa
gggaggatgcgcttccacaagctgcagaatgtgcagattgccctggactatctccgacat
cgccaggtgaagttagtgaacatcagaaatgatgacattgctgacggcaaccccaagctg
accctcggcctcatctggacaatcatcctgcacttccagatctcagacattcaggtgagc
ggacagtcggaggacatgacagcaaaggagaagctgctgctgtggtcacagcgtatggta
gagggctaccaaggcctgcgctgtgacaacttcaccaccagttggcgcgatggccgtctc
ttcaatgctatcatccaccggcacaagcccatgctcatagatatgaataaagtgtatcga
cagaccaacctggagaacctagaccaggcattctcggtggcagagcgggacctgggagtt
acacggctcctggacccagaagatgtggacgtccctcagcctgatgaaaagtccatcatc
acctatgtttcatccctgtacgatgctatgccccgcgtgcctggtgcacaggacggagtg
agggccaatgagctgcagcttcgttggcaggagtaccgggagcttgtgttgctgctgctg
caatggatccggcaccacaccgctgcttttgaggagcgcaagttcccctccagctttgaa
gagattgagatcctatggtgccagtttttgaagttcaaggagacagaacttcctgccaag
gaggcagacaaaaaccggtccaaagttatctaccagtctttggagggggcagtacaagcg
ggccagctcaagattccccctggctaccacccactagatgtggagaaggagtggggcaag
ctgcatgtggccatcctggagcgggagaagcaactgcgaagcgagtttgagaggctggag
tgtcttcagcgcattgtgagcaagctacagatggaggctgggctgtgtgaggagcagctg
aaccaggcggacgccctactgcagtcggatattcggctgctggcctcaggcaaggtggct
cagcgagctggggaagtcgagagagacctggacaaggctgatggtatgatccggctgttg
ttcaatgatgtgcagacccttaaagatgggcggcatccacagggtgaacagatgtaccgg
agggtgtatcgtctgcatgagcgcctggtagccatccgcactgagtacaacctccggctg
aaggcaggagtgggtgcccctgtgacccaggtgaccctgcagagtacacagaggcgccca
gagctagaggactccacactgcgctacctgcaagacctgctggcctgggtagaggagaac
cagcgtcgaatagacagtgctgagtggggcgtggacttgcccagtgtggaggcccagctg
ggcagccaccgaggcatgcatcagtctatagaggaatttcgggccaagatcgagcgggct
cggaatgatgagagccagctctcccctgccacccggggtgcctaccgggactgcctaggt
cgcctagacctgcagtatgcaaagctgctgaactcctccaaggcccgcctccggtccctg
gagagcttgcacgggtttgtggcggcagctaccaaggagctgatgtggctgaatgagaaa
gaagaggaggaagtgggctttgattggagtgaccgcaataccaacatggcagccaagaaa
gaaagttactcggccctgatgcgagaactggaaatgaaggaaaagaaaatcaaggagatc
cagaacacaggggacaggctgctgcgggaagaccatcctgcccggcccacggtggagtcc
ttccaggctgccttgcagacacagtggagctggatgctgcagctgtgttgctgcattgaa
gcacacttgaaagagaatacagcctacttccagttcttctcagatgttcgggaggcggag
gaacagttgcagaagctacaggagacgttacgcaggaagtacagctgtgaccgcaccatc
accgtcaccaggctcgaggatctgctgcaggatgcccaggatgagaaggaacaactgaat
gagtacaaggggcacctctcaggcctggccaagcgggccaaggctattgtgcagttgaag
ccacgcaaccctgcccacccggtgcggggccacgtgcccctgatagccgtgtgtgactac
aagcaggtggaggtgactgtgcacaagggtgaccaatgccagctggtgggtcctgcccag
ccatcccactggaaggtgctcagtggttccagcagcgaggccgctgtgccttctgtgtgc
tttcttgtgccgccgcccaaccaggaggcccaggaagctgtcgctagactggaggcgcag
catcaggccctggtcacactgtggcaccagcttcacgtggacatgaagagccttctggcg
tggcagagcctcagtcgggacatacagctcatccggtcctggtccctagtcacgttccgc
acactgaagcccgaggagcagcgacaagctctgcgcaacctggaattgcactaccaggcc
ttccttcgagacagccaggatgccggtggctttgggcctgaggaccgtctagtggcagag
cgcgagtatggatcttgcagccgccattaccagcagttactacaaagcctggagcagggt
gagcaggaggagtcccgctgtcagcgatgcatctcggagctcaaggatatccggctgcag
ctggaggcctgtgagactcggactgtgcaccgtctgcggctgccactggataaggacccc
gcacgggagtgcgcccagcgcatcgctgagcaacagaaagcgcaggctgaggtggagggg
ctgggcaagggagttgcccggctgtctgctgaggctgagaaagttctagccttgccagag
ccgtcacctgctgcacccactctgcgctcggagttggaactgaccctgggcaagctggaa
caggtccgaagcctgtctgccatctacctggagaaactcaagaccatcagcttggtgatt
cgcagtacccagggggctgaggaggtgcttaaaacccatgaggagcagctgaaggaggcc
caggctgtgcctgccactctccaagagcttgaagccaccaaggcctcactaaagaagctg
cgggcccaggccgaggcacagcagccagtattcaacaccctaagagatgagttgcggggg
gcacaggaggttggtgagcggctacagcagcggcatggtgagcgggacgtagaagttgag
cgctggcgagaacgtgtcactcagttgctggagcgctggcaggctgttctagcccagaca
gatgtgcggcagcgtgagctcgagcagctgggccgccagcttcgctactatcgtgagagc
gcggatcctctgagcgcctggctgcaggatgccaagaggcggcaagagcagatccaggcc
gtgccaatagccaactgtcaggctgcgcgagaacagctgcgccaggagaaggccctgctg
gaggagattgagcgtcatggtgagaaggttgaggagtgccagaagtttgctaagcagtac
atcaatgcaatcaaggactatgagctccagctgatcacgtacaaggctcagcttgaaccc
gtggcctcccctgccaagaagcccaaggttcagtctggatcggagagcgtcatccaggag
tacgtggatctgcgcacgcgctacagcgagctgaccacgctcacgagccagtatatcaag
ttcatcagtgagacccttcgccgcatggaagaggaggagcggctggctgagcaacagcgg
gcagaggagcgggagcgactggccgaggtggaggctgcgctggagaagcagcggcagcta
gctgaggcacacgcccaggctaaggcccaggcagagctggaagcacaagaactgcagcgg
cgcatgcaggaggaggtggcgcggcgcgaggaggcagcagtggacgcacagcagcagaag
cgcagcatccaagaggagctgcagcacctgaggcagagctcggaggcagagatccaggcc
aaggcccagcaggtggaggctgcagaacgcagccggatgcgcattgaggaagagatccgt
gtagtacgtctgcagctggagacaactgagcggcagcgtggaggggcggagggcgagctg
caggctctgcgcgctcgggctgaggaggcagaagcgcagaagcggcaggctcaggaggaa
gctgaacgcttgcgaaggcaggtgcaggatgagagccagcgcaaacggcaggcagaggca
gagctggccctgcgtgtgaaggctgaagctgaggcagcgcgagagaagcagagggccctg
caggccctggatgagctgagactgcaggccgaggaggccgagcggcggctgcgccaagcc
gaggcagagcgggcacgccaagtgcaggtggccctggagacggcacagcgcagtgcggaa
gtggagctgcagagcaagcgggcatcctttgcagagaagaccgcacaattggagcgcact
ctgcaggaggagcatgtaacagtggcccagctgcgggaggaggccgagcgacgggcacag
cagcaagctgaggctgagcgagcccgggaggaagctgagcgggagctggagcgctggcag
ctgaaggccaatgaagcactgcggctgcggctgcaggcagaagaggtggcacagcagaag
agcctggcacaggccgatgccgagaagcagaaggaagaggccgagcgggaagcgcggcgg
cggggcaaggcggaggagcaggctgtgcggcagcgggagctggcggagcaggagctggag
aagcagcggcagctggcggagggcaccgcacagcagcgcctggctgcggagcaagagctg
atccgcctgcgggccgagacagagcaaggtgagcagcagcggcagctgctggaggaagag
ctggcccggctacagcacgaggccaccgcagccacgcagaagcgccaggagctggaggct
gaactggctaaggtccgggcagagatggaggtacttctggccagcaaggcgcgagccgag
gaagagtctcgctctaccagcgaaaagtctaagcagaggctagaggctgaggcaggccgc
tttcgggaactggccgaggaggctgcccggctgcgtgctctggcggaggaggccaagagg
cagaggcagttggcagaggaggatgccgcccgccagcgggccgaggcagagcgggtgctt
actgagaagctggctgccatcagtgaggccacacggctcaagacggaggcagagattgca
ctcaaagagaaggaggccgagaatgagcgcctgaggcgcctggcagaagacgaggccttc
cagcggcggcgtctggaggagcaggcggcactgcacaaggctgacatcgaggagcgcctg
gcccagctgcgcaaggcatcagagagcgagctggagcggcagaagggcttggtggaggac
accctgcgacagcggcggcaggtggaggaggagatcatggcgctgaaggtgagctttgag
aaagccgccgcgggcaaggcagagctggagctggagctggggcgcattcgcagcaacgcg
gaggacacaatgcgcagcaaggagcaggcggaactggaggcggcccggcagcggcagttg
gcggcagaggaggagcagaggcgccgggaggccgaggagcgcgtgcagaggagcctggca
gcggaggaggaagccgctcggcagcgcaaggtggcactggaggaggtcgagcgactcaag
gccaaggttgaagaagcacggcgcctgcgagagcgggcagagcaggagtcggccaggcag
ctgcagctggcccaggaggccgcccagaaacggctgcaggcggaggagaaggcacacgcc
tttgtggtgcagcagcgagaggaggagctgcagcagacgcttcagcaagagcagaacatg
ctggatcggctgcggagtgaggcagaggcagcgaggcgagccgccgaggaggcggaggag
gcccgggagcaggcggagcgcgaggcagcgcagtctcggaaacaagtggaagaggccgag
cggctgaaacagtcagcagaggagcaggctcaggcccaggctcaggcgcaggcggccgca
gagaagctgcgcaaggaagcggagcaggaggcggcgcgtcgggcccaggcagagcaggca
gcgctgaaacagaagcaggcagccgacgcggagatggagaagcataaaaagtttgcagag
cagacactccggcagaaggcccaggtagagcaggagctgaccacactgaggctgcagcta
gaggagactgaccaccagaagagcatcctggatgaggagctgcagcgactaaaggccgag
gtaacagaggcagcccggcagcgcagccaggtagaggaggagctcttctctgtccgtgtg
cagatggaggagctgggcaagctcaaggctcgcattgaagctgaaaaccgggccctcatc
cttcgtgacaaggacaacacacagcgcttcctggaggaggaggccgagaagatgaaacag
gtggccgaggaagcggcacggttgagcgtggccgcccaggaggcagcacggctgaggcag
ctagcggaggaggacctggcgcagcagcgggccctggcagagaagatgctgaaggagaag
atgcaggcggtgcaggaagccacgaggctcaaggccgaggctgagctgctgcagcagcag
aaggagcttgcccaggagcaggcccggcggctgcaggaggacaaggagcaaatggctcag
cagttggtagaggagacacagggtttccagaggactctggaggccgagcggcagcggcag
ctggagatgagcgcggaggccgagcgcctcaagctgcgcatggctgagatgagccgggct
caggcccgcgcggaggaggacgcccagcgcttccggaagcaggctgaagagatcggcgag
aagctgcaccgcactgaacttgcgacacaggagaaggtgacgttggtgcagacgctggag
atccagcgacagcagagtgaccacgatgccgagcgtctgagggaggccattgcggagctg
gagcgtgagaaggagaagctcaagcaggaggcgaagttactgcagctcaagtcggaggag
atgcagactgtgcagcaggagcagatactgcaggagacccaggccctgcagaagagcttc
ctctctgagaaggacagcctgctgcagcgcgagcgcttcatcgagcaggagaaggccaag
ctggagcagctcttccaggacgaggtggctaaagcaaagcagctgcgtgaggagcagcag
cggcagcagcagcagatggaacaggaaaagcaggagctgatggccagcatggaggaggcc
aggaggcggcagcgcgaggctgaggagggcgtgaggcgcaagcaagaggaactgcagcat
ctggagcagcagcggcagcagcaggagaagctcctggcggaggaaaaccagcggctgcga
gagcggctgcagcgcctggaggaagagcaccgcgctgccttggctcactctgagatcgcc
accacccaggccgcttccacgaaggcactgcccaacggccgggatgcacccgatggcccg
tccgtggaggctgaacccgagtacacctttgagggactacgtcagaaggtgccggcccag
cagctacaggaagcaggcatcctgagccaggaggaactgcagcgtttggcacagggtcac
accacggtggctgagctcacgcagcgggaagatgtgtaccggtacctgaagggccgcagc
agcattgcaggactgttactgaagcccaccaatgagaaactgagtgtctacacagcccta
cagcggcagctgctcagccccggaacagctctgatcttgctggaggcccaggcagcctcg
ggcttcctgctggatcctgtgcggaatcggcggctgacagtcaatgaggctgtgaaggag
ggtgtcgtgggtcctgagctgcaccacaaactgctgtcagctgagcgtgccgtcaccggc
tacaaggacccctatacaggggaacagatctcgctcttccaggccatgaagaaggacctt
attgtcagggaccatggcgtccgcctgctggaggcccagatcgccaccggtggcatcatt
gatcctgtgcacagccaccgtgtgcctgtggacgtggcctacaaacgtggctacttcgat
gaagagatgaaccgcatcttgtctgacccaagcgatgacaccaagggcttcttcgacccc
aacacccacgagaacctcacttacctgcagctgctggagcgctgtgtggaggaccccgag
accggcctgcgcctcctgccactcacagataaggctgccaagggtggcgagctggtgtac
accgatacggaggcccgtgacgtcttcgaaaaggccaccgtgtctgcaccgtttggcaag
ttccagggcaggaccgtgaccatctgggagatcatcaactcggagtacttcacggcggaa
cagcgacgggacctgctgcagcagttccgcacgggccacatcacggtggagaaaatcatc
aaaatcgtcatcacagtggtggaggaacacgagcggaagggccagctctgctttgagggc
ctccgtgccctcgtgcccgccgcagagctgctggacagtggggtcatcagccacgaactc
taccagcagctgcagcggggtgagcgttctgtgcgggaagtggccgaggcggacagcgtg
aggcaggccctgcggggtaccaatgtcatcgccggtgtgtggctggaagaagcagggcag
aagctgagcatctatgaggccctgaagaaagacttgctgcagccagaggtggctgtggcc
ttgctggaggcccaggctggcactgggcatatcatcgaccctgccaccagcgccaggctg
actgtggacgaggcggtgcgtgctggcctggtggggcctgagctgcacgagaagctgctg
tcagccgagaaggccgtgacaggctacagggatccctactcaggacagagtgtctcactg
ttccaggccttgaagaagggtctcatcccccgagaacagggcctgcgcctgctggatgcc
cagttatccactggtggcattgtagaccccagcaaaagccaccgtgtgcccctggatgtt
gcctatgcccggggctacctggacaaagagactaacagggccctgacgtcacccagagat
gatgccagagtctaccatgaccccagcacccaggagccagtcacctacagccagctccaa
cagcggtgccggtctgaccagctgaccggcttgagcctactgccactctcagagaaggcc
gtccgggcccggcaggaggaggtctactctgagctccaggcccgggagacactggagcag
gccaaggttgaggttcctgtgggcagctttaagggcagggcgatgactgtgtgggagctc
atcagctctgaatactttactgaggagcagcggcaggagttgctgcggcagttccgcaca
ggcaaggtcaccgtggagaaggtcatcaagattgtcatcaccatcgtggaggaggtggag
actcggcggcaggagagactgtcctttagtggcctccgtgcccctgtgccggccagtgag
ctcctggacgccaagatcctcagcagagctcagtttgaccagctcaaggatggcaagaca
tcagtcaaagagctgtccgaggtgggctccgtgcggactctgctgcagggcagcggctgc
ctggccggcatctatctggaggactcgaaggagaaagtaaccatctatgaggccatgcgc
cggggcctcctcagacccagcacagccacgctcctgctggaggcccaggcagccactggt
ttcctggtggaccctgtgcggaaccaacgtctgtatgtccatgaggctgtcaaggcgggc
gtagtgggccctgaactccatgagaagctgctgtcggccgagaaggccgtcactggctac
aaggatccctactcgggcaacaccatctcgctgttccaggccatgaaaaagggcctggtc
ctcagggaccatgccatccgcctgctggaggcccaggtcgccacgggtggcatcatcgac
ccggtgcacagccaccgcctgcctgtggacgtggcctaccagcgtggctacttcgatgag
gagatgaaccgtgtgctggcagatccaagtgatgacaccaagggcttctttgaccccaac
acccacgagaacctcacctacctgcagctgctggagcgctgtgtggaggaccccgagacc
ggcctgcgcctcctgccactcaaaggggcagagaagaccgaggtggtagaaaccacacag
gtgtatactgaggaggagactcggagggcgttcgaggagacgcagattgacatcccgggt
ggtggcagccacggtggctcctccatgtctctgtgggaggtgatgcagtcaaacatgatc
ccggaggatcagcgtgcccggctcatggctgactttcaggctgggagggtaaccaaggaa
cgcatgatcattatcatcatcgaaatcatcgagaagaccgagatcatccgccagcagaac
ctggcctcctatgactacgtgcgccgccgcctcactgccgaagacctgtacgaggcccgg
atcatctcccttgagacctacaacctcttccgggaaggcaccaagaacctccgtgaagtg
ctggagatggaatctgcctggcgctacctttacggcacaggcgcggtggccggtgtctac
ctgcctggctccaggcagacgctaaccatctaccaggcccttaagaaggggttgctgagt
gccgaggtggcccgcttattgctggaagcacaggcagccacgggcttcctgctggaccca
gtgaagggggagcggctgaccgtggatgaggctgtgcggaagggcctggtaggccccgag
ctgcatgaccgcctcctctctgccgagcgagctgtaactggttaccgagacccctacacg
gaacagaccatctcactcttccaggccatgaagaaggagctgatccctgctgaggaggcg
ctgaggctgctggatgcgcagctagccacaggaggcattgtggacccccgcctgggtttc
cacctccctctggaggtggcttaccaacgcggctacctcaataaggacacgcacgaccag
ctgtcggagcccagcgaggtgcgcagctacgtggacccctccacggatgagcggctcagc
tacacacagctgctcaagcgttgccgccgtgatgaccccagcggccagatgctgctgctg
ctctctgatgcccgcaagctgaccttccgcggtctccgcaagcagatcactgtggaggag
ctggtacgctctcaagtcatggacgaggccacagcgctacagctacaagaaggcctgacc
tccatcgaggaggtcactaagaacctgcagaagttcctcgagggtaccagctgcattgcc
ggagtctttgttgatgccaccaaggaacggctctcggtgtaccaggctatgaagaagggc
atcatccgccccgggacagcctttgagctcctggaagcacaggcagccaccggctatgtc
attgaccccatcaagggactcaagctgacggtggaagaagccgttcgtatgggtattgtg
ggccccgagttcaaggacaagctgctgtcagctgagcgtgccgtcactggctacaaggac
ccctactctgggaaactcatctccctcttccaggccatgaagaagggcctgatcctgaag
gaccatggcatccgtctgctggaggctcagatcgccactgggggcatcattgaccccgag
gagagccaccgtttgcctgtggaagtggcctataagcgcggcctctttgatgaggagatg
aacgagatcttgactgatccctcagatgacaccaagggtttctttgaccccaacacagag
gagaacctcacttacctgcagctgatggagcgctgcatcactgacccccagacgggcctg
tgtctcctgcccctgaaggagaagaagcgggaacggaagacatcctccaagtcctcagtg
cgcaagcgccgcgtggtgattgtggacccagagacgggcaaggagatgtctgtgtacgag
gcctaccgcaagggtctcattgaccaccagacgtacctggagttgtcggagcaggagtgt
gagtgggaagagatcaccatctcctcctcagatggcgtcgtcaagtctatgatcatcgac
cgccgctctggtcgccagtatgacatcgacgacgccatcaccaagaacctcattgaccgc
tcagcactggaccagtaccgcgctggtacgctttcgatcactgagtttgctgacatgctc
tcaggcaatgccggtggcttccgttcccgctcctcctctgtgggctcatcttcctcctac
cccatcagttctgctggccccaggacccagctagcctcctggtctgatccgactgaggag
actggccccgtggccggcatcctggacacagagactctggagaaggtgtccatcacggag
gccatgcaccgcaacctggtagacaacatcaccggccagcggctgctggaggcccaagcc
tgcaccgggggcatcattgaccccagcactggtgagcgcttcccggtcactgaagctgtc
aacaagggcctggtggacaagatcatggtagaccgtatcaatctggcccagaaggccttc
tgtgggtttgaggacccacgcaccaagaccaagatgtcagctgcccaggccctgaagaag
ggctggctgtactatgaggcaggccagcgtttcctggaggtgcagtacctgaccggtggt
ctgatcgagcctgacacgcccggccgtgtgtctctcgacgaagctctgcaacgtggcact
gtggatgcccgcacagcccagaagctgcgtgatgtcagtgcttactccaagtacctcacg
tgccccaagaccaagctcaagatctcctacaaggacgctctggaccgtagcatggtggag
gagggcacggggctgaggctgctggaggctgcggcacagtccagcaagggctactacagc
ccgtacagcgtcagtggctctggctcgaccgccggctcacgcactggttcacgcaccggc
tccagggccggctcccggcgtggcagctttgatgccactggctctggcttctccatgacc
ttttcttcttcctcctactcttcctcaggctatggccgccgctatgcctcagggccttca
gcctctcttgggggccctgagtctgcagtggcctga

DBGET integrated database retrieval system