KEGG   Mus musculus (mouse): 18813
Entry
18813             CDS       T01002                                 

Symbol
Pa2g4, 38kDa, AA672939, Ebp, Ebp1, P, Plfap
Name
(RefSeq) proliferation-associated 2G4
Organism
mmu  Mus musculus (mouse)
SSDB
Motif
Pfam: Peptidase_M24 TraC
Other DBs
NCBI-GeneID: 18813
NCBI-ProteinID: NP_035249
MGI: 894684
Ensembl: ENSMUSG00000025364
Vega: OTTMUSG00000024830
UniProt: P50580 Q3TGU7
Structure
PDB: 
2V6C

Position
10; 10 D3
AA seq 394 aa
MSGEDEQQEQTIAEDLVVTKYKMGGDIANRVLRSLVEASSSGVSVLSLCEKGDAMIMEET
GKIFKKEKEMKKGIAFPTSISVNNCVCHFSPLKSDQDYILKEGDLVKIDLGVHVDGFIAN
VAHTFVIGVAQGTQVTGRKADVIKAAHLCAEAALRLVKPGNQNTQVTEAWNKVAHSFNCT
PIEGMLSHQLKQHVIDGEKTIIQNPTDQQKKDHEKAEFEVHEVYAVDVLVSSGEGKAKDA
GQRTTIYKRDPSKQYGLKMKTSRAFFSEVERRFDAMPFTLRAFEDEKKARMGVVECAKHE
LLQPFNVLYEKEGEFVAQFKFTVLLMPNGPMRITSGPFEPDLYKSEMEVQDAELKALLQS
SASRKTQKKKKKKASKTVENATSGETLEENGAGD
NT seq 1185 nt   +upstreamnt  +downstreamnt
atgtcgggcgaagacgagcagcaggagcaaactatcgccgaggacctggtcgtgaccaag
tataagatggggggcgacatcgccaaccgggtgcttcgatctttggtggaggcttccagc
tcaggtgtgtctgtgctgagcttgtgtgagaaaggtgatgccatgattatggaagagaca
gggaagatcttcaagaaggaaaaggagatgaagaaaggtattgcctttcctaccagcatt
tccgtaaataactgtgtgtgtcacttctcccctttgaagagtgaccaggactatatactc
aaggaaggtgacttggtaaaaattgaccttggggttcatgtggatggcttcattgccaat
gtggctcacacttttgtaattggtgtagctcaggggacccaggtaacagggcggaaagca
gatgtcattaaggccgctcacctatgtgctgaagctgccttacgactggtcaaacctgga
aaccagaacacacaagtgactgaagcatggaacaaggttgctcactcatttaactgcaca
ccaatagaaggtatgctgtcacaccaattgaagcagcatgtgattgatggagagaagacg
attatccagaaccctacagaccagcagaagaaggaccatgaaaaggcagaatttgaggtg
catgaggtttatgctgtagatgtcctcgtcagctcaggagaaggcaaggccaaagatgca
ggacagagaaccaccatctacaagcgagacccctctaaacaatatggcctgaaaatgaaa
acttcacgtgcctttttcagtgaggtggaacggcgttttgatgccatgccgtttacttta
agagcatttgaagatgagaagaaggctcgaatgggtgtggtagagtgtgccaaacatgag
ttactacagccatttaacgttctctatgagaaggagggtgaatttgttgcccagtttaaa
tttacagttctactcatgcccaacggccccatgcggataaccagtggtccctttgagcct
gacctgtacaagtctgagatggaggttcaagatgcagagctgaaggctcttctccagagt
tctgcaagtagaaaaacccagaaaaagaagaaaaagaaggcctccaagactgtagagaat
gccaccagtggagaaaccttagaagagaatggagctggggactga

DBGET integrated database retrieval system