KEGG   Mus musculus (mouse): 18815
Entry
18815             CDS       T01002                                 

Gene name
Plg, AI649309, P, Pg
Definition
(RefSeq) plasminogen
  KO
K01315  plasminogen [EC:3.4.21.7]
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04080  Neuroactive ligand-receptor interaction
mmu04610  Complement and coagulation cascades
mmu05150  Staphylococcus aureus infection
mmu05164  Influenza A
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    18815 (Plg)
 09150 Organismal Systems
  09151 Immune system
   04610 Complement and coagulation cascades
    18815 (Plg)
 09160 Human Diseases
  09172 Infectious disease: viral
   05164 Influenza A
    18815 (Plg)
  09171 Infectious disease: bacterial
   05150 Staphylococcus aureus infection
    18815 (Plg)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:mmu01002]
    18815 (Plg)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:mmu04147]
    18815 (Plg)
Enzymes [BR:mmu01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.21  Serine endopeptidases
    3.4.21.7  plasmin
     18815 (Plg)
Peptidases and inhibitors [BR:mmu01002]
 Serine peptidases
  Family S1: chymotrypsin family
   18815 (Plg)
Exosome [BR:mmu04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   18815 (Plg)
SSDB
Motif
Pfam: Kringle Trypsin PAN_1 Trypsin_2 DUF1986 DUF3719
Other DBs
NCBI-GeneID: 18815
NCBI-ProteinID: NP_032903
MGI: 97620
Ensembl: ENSMUSG00000059481
UniProt: P20918 Q3V1T9
Position
17 A1; 17 8.5 cM
AA seq 812 aa
MDHKEVILLFLLLLKPGQGDSLDGYISTQGASLFSLTKKQLAAGGVSDCLAKCEGETDFV
CRSFQYHSKEQQCVIMAENSKTSSIIRMRDVILFEKRVYLSECKTGIGNGYRGTMSRTKS
GVACQKWGATFPHVPNYSPSTHPNEGLEENYCRNPDNDEQGPWCYTTDPDKRYDYCNIPE
CEEECMYCSGEKYEGKISKTMSGLDCQAWDSQSPHAHGYIPAKFPSKNLKMNYCRNPDGE
PRPWCFTTDPTKRWEYCDIPRCTTPPPPPSPTYQCLKGRGENYRGTVSVTVSGKTCQRWS
EQTPHRHNRTPENFPCKNLEENYCRNPDGETAPWCYTTDSQLRWEYCEIPSCESSASPDQ
SDSSVPPEEQTPVVQECYQSDGQSYRGTSSTTITGKKCQSWAAMFPHRHSKTPENFPDAG
LEMNYCRNPDGDKGPWCYTTDPSVRWEYCNLKRCSETGGSVVELPTVSQEPSGPSDSETD
CMYGNGKDYRGKTAVTAAGTPCQGWAAQEPHRHSIFTPQTNPRAGLEKNYCRNPDGDVNG
PWCYTTNPRKLYDYCDIPLCASASSFECGKPQVEPKKCPGRVVGGCVANPHSWPWQISLR
TRFTGQHFCGGTLIAPEWVLTAAHCLEKSSRPEFYKVILGAHEEYIRGLDVQEISVAKLI
LEPNNRDIALLKLSRPATITDKVIPACLPSPNYMVADRTICYITGWGETQGTFGAGRLKE
AQLPVIENKVCNRVEYLNNRVKSTELCAGQLAGGVDSCQGDSGGPLVCFEKDKYILQGVT
SWGLGCARPNKPGVYVRVSRFVDWIEREMRNN
NT seq 2439 nt   +upstreamnt  +downstreamnt
atggaccataaggaagtaatccttctgtttctcttgcttctgaaaccaggacaaggggac
tcgctggatggctacataagcacacaaggggcttcactgttcagtctcaccaagaagcag
ctcgcagcaggaggtgtctcggactgtttggccaaatgtgaaggggaaacagactttgtc
tgcaggtcattccagtaccacagcaaagagcagcaatgcgtgatcatggcggagaacagc
aagacttcctccatcatccggatgagagacgtcatcttattcgaaaagagagtgtatctg
tcagaatgtaagaccggcatcggcaacggctacagaggaaccatgtccaggacaaagagt
ggtgttgcctgtcaaaagtggggtgccacgttcccccacgtacccaactactctcccagt
acacatcccaatgagggactagaagagaactactgtaggaacccagacaatgatgaacaa
gggccttggtgctacactacagatccggacaagagatatgactactgcaacattcctgaa
tgtgaagaggaatgcatgtactgcagtggagaaaagtatgagggcaaaatctccaagacc
atgtctggacttgactgccaggcctgggattctcagagcccacatgctcatggatacatc
cctgccaaatttccaagcaagaacctgaagatgaattattgccgcaaccctgacggggag
ccaaggccctggtgcttcacaacagaccccaccaaacgctgggaatactgtgacatcccc
cgctgcacaacacccccgcccccacccagcccaacctaccaatgtctgaaaggaagaggt
gaaaattaccgagggaccgtgtctgtcaccgtgtctgggaaaacctgtcagcgctggagt
gagcaaacccctcataggcacaacaggacaccagaaaatttcccctgcaaaaatctggaa
gagaactactgccggaacccagatggagaaactgctccctggtgctataccactgacagc
cagctgaggtgggagtactgtgagattccatcctgcgagtcctcagcatcaccagaccag
tcagattcctcagttccaccagaggagcaaacacctgtggtccaggaatgctaccagagc
gatgggcagagctatcggggtacatcgtccactaccatcacagggaagaagtgccagtcc
tgggcagctatgtttccacacaggcattcgaagaccccagagaacttcccagatgctggc
ttggagatgaactactgcaggaacccggatggtgacaagggcccttggtgctacaccact
gacccgagcgtcaggtgggaatactgcaacctgaagcggtgctcagagacaggagggagt
gttgtggaattgcccacagtttcccaggaaccaagtgggccgagcgactctgagacagac
tgcatgtatgggaatggcaaagactatcggggcaaaacggccgtcactgcagctggcacc
ccctgccagggatgggctgcccaggagccccacaggcacagcatcttcaccccacagaca
aacccacgggcaggtctggaaaagaactactgccgaaacccagatggggatgtgaatggt
ccttggtgctatacaacaaaccccagaaaactttatgactattgtgacatccccctgtgt
gcatcagcatcatcctttgagtgcgggaaacctcaggtggaaccgaagaaatgccctggg
agggtggtgggtggctgcgtggccaaccctcactcctggccctggcaaatcagccttaga
acaagatttaccggacagcacttctgtggcggtactttaatagccccagagtgggttctg
actgctgcccactgtttggagaaatcttcaagacctgaattctacaaggttatcctgggt
gcgcacgaagaatatatccgtgggttggatgttcaggaaatatcagtagccaaactgatc
ttggagcccaacaaccgtgacattgccctgctgaaactaagccgcccagccaccatcacg
gataaagtcattccagcttgtctgccatctccaaattacatggttgctgaccggacaata
tgttacatcaccggctggggagagactcaagggactttcggtgccggtcgtctcaaggag
gctcagctgcctgtgattgagaacaaggtgtgcaaccgcgtcgagtatctgaacaacaga
gtcaaatccacggagctctgtgccgggcaactggctggtggcgtcgacagctgccagggc
gacagtggaggacctctggtttgcttcgagaaggacaagtacattttacaaggagtcact
tcttggggtcttggctgtgctcgccccaataagcctggtgtctacgttcgtgtctcacgg
tttgttgattggattgaaagggagatgaggaataactga

DBGET integrated database retrieval system