KEGG   Mus musculus (mouse): 18816
Entry
18816             CDS       T01002                                 

Gene name
Serpinf2, AI747498, Pli, Serpimf2
Definition
(RefSeq) serine (or cysteine) peptidase inhibitor, clade F, member 2
  KO
K03983  alpha-2-antiplasmin
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04610  Complement and coagulation cascades
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09150 Organismal Systems
  09151 Immune system
   04610 Complement and coagulation cascades
    18816 (Serpinf2)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:mmu01002]
    18816 (Serpinf2)
Peptidases and inhibitors [BR:mmu01002]
 Peptidase inhibitors
  Family I4: serpin family
   18816 (Serpinf2)
SSDB
Motif
Pfam: Serpin
Other DBs
NCBI-GeneID: 18816
NCBI-ProteinID: NP_032904
MGI: 107173
Ensembl: ENSMUSG00000038224
Vega: OTTMUSG00000006204
UniProt: Q61247 Q5ND36
Structure
PDB: 
2R9Y

Position
11; 11 B5
AA seq 491 aa
MALLRGLLVLSLSCLQGPCFTFSPVSAVDLPGQQPVSEQAQQKLPLPALFKLDNQDFGDH
ATLKRSPGHCKSVPTAEETRRLAQAMMAFTTDLFSLVAQTSTSSNLVLSPLSVALALSHL
ALGAQNQTLHSLHRVLHMNTGSCLPHLLSHFYQNLGPGTIRLAARIYLQKGFPIKDDFLE
QSERLFGAKPVKLTGKQEEDLANINQWVKEATEGKIEDFLSELPDSTVLLLLNAIHFHGF
WRTKFDPSLTQKDFFHLDERFTVSVDMMHAVSYPLRWFLLEQPEIQVAHFPFKNNMSFVV
VMPTYFEWNVSEVLANLTWDTLYHPSLQERPTKVWLPKLHLQQQLDLVATLSQLGLQELF
QGPDLRGISEQNLVVSSVQHQSTMELSEAGVEAAAATSVAMNRMSLSSFTVNRPFLFFIM
EDTIGVPLFVGSVRNPNPSALPQLQEQRDSPDNRLIGQNDKADFHGGKTFGPDLKLAPRM
EEDYPQFSSPK
NT seq 1476 nt   +upstreamnt  +downstreamnt
atggcactgctccgggggctcctcgtactcagcttgtcctgcctgcaaggtccctgtttc
acgttctctccggtgagcgccgtggatctcccgggccagcagccagtgagtgagcaggcc
cagcagaagctgcccctgcctgccctcttcaagttggacaaccaggattttggtgaccat
gctaccctcaagaggtccccaggacactgcaagagtgtcccaactgcagaggagactcgc
aggctggctcaggccatgatggcttttactactgacctgttctctttggtggcccaaaca
tctaccagctccaaccttgtcctgtcaccccttagtgtggccctagcactctctcacctg
gcactaggtgctcagaaccaaacactacacagcttgcatcgagtgttgcacatgaacaca
ggatcctgcctcccgcatctactgagccatttctaccagaacctaggcccagggacaatc
cgactggctgccagaatatacctgcagaaaggatttcccatcaaagacgatttcctggag
caatcggaaaggctctttggtgcgaagcccgtgaaactgactggaaagcaggaggaagac
ctggcgaacatcaaccaatgggtgaaggaggccacagaggggaagattgaggatttcctc
tctgagctgccggatagcaccgtgctgcttctcctcaacgccatccactttcacggtttc
tggaggaccaagtttgacccgagcctcacccagaaagatttcttccacctggatgagcgg
ttcacagtgtcggtggacatgatgcacgcggtgtcatatcctcttcgatggttcctgctg
gagcaacctgagatacaggtggctcatttcccctttaagaacaacatgagctttgtggtc
gtgatgcccacttattttgagtggaacgtgtccgaggtactagccaacctgacctgggat
actctgtaccatccctcgctgcaggagaggcccaccaaggtgtggctgcctaaactccat
ctgcaacagcagctggacctggtggccaccctcagccaactgggcctgcaggaattgttc
cagggcccagaccttcgtgggatctctgagcagaatctggtggtgtctagcgtgcaacat
cagtctaccatggagctcagcgaggctggtgtggaggcagccgcagctaccagcgtagcc
atgaatcgaatgtccctctcctccttcactgtgaaccgacccttcctcttcttcatcatg
gaggacaccataggcgtgcccctctttgtgggcagtgtgaggaaccctaaccccagcgcg
ctgccccagctccaggaacagcgagattcccctgacaacaggctcataggccagaatgac
aaagctgacttccatggaggcaagacctttggtcctgacttgaaacttgcaccccgcatg
gaggaagactacccccagttcagctcccccaagtga

DBGET integrated database retrieval system