KEGG   Mus musculus (mouse): 18817
Entry
18817             CDS       T01002                                 

Gene name
Plk1, Plk, STPK13
Definition
(RefSeq) polo like kinase 1
  KO
K06631  polo-like kinase 1 [EC:2.7.11.21]
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04068  FoxO signaling pathway
mmu04110  Cell cycle
mmu04114  Oocyte meiosis
mmu04914  Progesterone-mediated oocyte maturation
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04068 FoxO signaling pathway
    18817 (Plk1)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    18817 (Plk1)
   04114 Oocyte meiosis
    18817 (Plk1)
 09150 Organismal Systems
  09152 Endocrine system
   04914 Progesterone-mediated oocyte maturation
    18817 (Plk1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:mmu01001]
    18817 (Plk1)
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:mmu03036]
    18817 (Plk1)
Enzymes [BR:mmu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.21  polo kinase
     18817 (Plk1)
Protein kinases [BR:mmu01001]
 Serine/threonine kinases: Other
  PLK family [OT]
   18817 (Plk1)
Chromosome and associated proteins [BR:mmu03036]
 Eukaryotic type
  Centromeric chromatin formation proteins
   SAC (spindle assembly checkpoint) factors
    Protein kinases
     18817 (Plk1)
  Centrosome formation and ciliogenesis proteins
   Kinases and associated factors
    18817 (Plk1)
  Sister chromatid separation proteins
   Polo kinases
    18817 (Plk1)
SSDB
Motif
Pfam: Pkinase POLO_box PK_Tyr_Ser-Thr Kinase-like Pkinase_fungal APH
Other DBs
NCBI-GeneID: 18817
NCBI-ProteinID: NP_035251
MGI: 97621
Ensembl: ENSMUSG00000030867
Vega: OTTMUSG00000058103
UniProt: Q07832 Q3TPZ2
Structure
PDB: 
5DMS 5DNJ 5DMV 5X3S

Position
7 F2; 7 65.52 cM
AA seq 603 aa
MNAAAKAGKLARAPADLGKGGVPGDAVPGAPVAAPLAKEIPEVLVDPRSRRQYVRGRFLG
KGGFAKCFEISDADTKEVFAGKIVPKSLLLKPHQKEKMSMEISIHRSLAHQHVVGFHDFF
EDSDFVFVVLELCRRRSLLELHKRRKALTEPEARYYLRQIVLGCQYLHRNQVIHRDLKLG
NLFLNEDLEVKIGDFGLATKVEYEGERKKTLCGTPNYIAPEVLSKKGHSFEVDVWSIGCI
MYTLLVGKPPFETSCLKETYLRIKKNEYSIPKHINPVAASLIQKMLQTDPTARPTIHELL
NDEFFTSGYIPARLPITCLTIPPRFSIAPSSLDPSSRKPLKVLNKGVENPLPDRPREKEE
PVVRETNEAIECHLSDLLQQLTSVNASKPSERGLVRQEEAEDPACIPIFWVSKWVDYSDK
YGLGYQLCDNSVGVLFNDSTRLILYNDGDSLQYIERDGTESYLTVSSHPNSLMKKITLLN
YFRNYMSEHLLKAGANITPREGDELARLPYLRTWFRTRSAIILHLSNGTVQINFFQDHTK
LILCPLMAAVTYINEKRDFQTYRLSLLEEYGCCKELASRLRYARTMVDKLLSSRSASNRL
KAS
NT seq 1812 nt   +upstreamnt  +downstreamnt
atgaatgcagcggccaaagctggaaagctggctcgagcaccagccgacctcgggaaaggt
ggggttccgggagatgcagttcccggtgccccagtggccgccccgctggcgaaagaaatt
ccggaggtcctagtggacccacgcagccggcggcagtatgtacgggggcgctttctgggt
aaaggaggcttcgccaaatgcttcgagatctcagacgcagacacaaaagaggtgttcgca
ggcaagatcgtgcctaagtctttgctgctcaagccccaccagaaggagaagatgtctatg
gagatctcaattcaccgcagcctagcacaccaacacgtcgtaggcttccatgactttttt
gaggacagcgactttgtatttgtagttttggagctctgtcgcaggaggtccctcctggag
ctgcacaagaggaggaaggcactgaccgagcctgaggcccgctactacctgcgacagata
gtcctgggctgccagtacctgcaccgcaatcaggtcattcacagggacctcaagctgggc
aacctcttcctgaacgaggatctggaggtgaaaataggggattttggcttggcaaccaaa
gtggaatatgaaggggaacgaaagaagaccttgtgtggcactcctaactacatagctcct
gaggtgctgagcaagaagggacacagttttgaggtggatgtgtggtccattgggtgcatc
atgtataccttgctagtgggcaagcctccctttgagacctcgtgcctaaaagagacctac
ctccggatcaagaaaaatgaatacagtattcccaagcacatcaacccagtggccgcctcc
ctcatccagaagatgcttcagacagaccccactgcccgccccaccattcacgagttgctc
aatgacgagttcttcacttctggctacatccccgcccgtctccctattacctgcctcacc
atcccaccaaggttttcaatcgctcccagcagcctggaccccagcagcaggaaacctctc
aaagtcctcaataaaggtgtggagaaccccctgcctgaccgtccccgggagaaagaggaa
ccggtggtccgggagacaaatgaggccattgagtgccaccttagtgacttgctacagcag
ctgaccagtgtcaacgcctccaagccctcggagcgcgggctggtgcggcaagaggaggct
gaggatcctgcctgcatccccatcttctgggtcagcaagtgggtggactattcggacaag
tatggccttgggtatcagctgtgtgacaacagtgtgggggtgctttttaatgactcaaca
cgcctgattctctacaatgacggggacagcctgcagtacatagagcgtgatggcacggag
tcctatctcactgtgagctcccatcccaattccttgatgaagaagatcactctcctcaac
tatttccgcaattacatgagtgagcacctgctgaaggcaggggccaacatcacaccccgg
gaaggcgacgagctggcccggctgccctacctacgaacgtggttccgcacacgcagcgcc
atcatcctgcacctcagcaacggcaccgtgcagattaacttcttccaggaccacaccaaa
cttatcctgtgccccctgatggcagcggtgacctacatcaacgagaagagggacttccaa
acgtaccgcctgagcctcctggaggagtatggctgctgcaaggagctggccagccgcctc
cgctacgcccgcaccatggtagacaagctgctgagctcgcgctccgccagcaaccgcctc
aaggcctcctag

DBGET integrated database retrieval system