KEGG   Mus musculus (house mouse): 18823
Entry
18823             CDS       T01002                                 
Symbol
Plp1, DM20, Plp, jimpy, jp, msd, rsh
Name
(RefSeq) proteolipid protein (myelin) 1
  KO
K17271  myelin proteolipid protein
Organism
mmu  Mus musculus (house mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:mmu04147]
    18823 (Plp1)
Exosome [BR:mmu04147]
 Exosomal proteins
  Exosomal proteins of oligodendrocytes
   18823 (Plp1)
SSDB
Motif
Pfam: Myelin_PLP
Other DBs
NCBI-GeneID: 18823
NCBI-ProteinID: NP_035253
MGI: 97623
Ensembl: ENSMUSG00000031425
UniProt: P60202 Q3UYM8
Position
X:135720897..135739331
AA seq 277 aa
MGLLECCARCLVGAPFASLVATGLCFFGVALFCGCGHEALTGTEKLIETYFSKNYQDYEY
LINVIHAFQYVIYGTASFFFLYGALLLAEGFYTTGAVRQIFGDYKTTICGKGLSATVTGG
QKGRGSRGQHQAHSLERVCHCLGKWLGHPDKFVGITYALTVVWLLVFACSAVPVYIYFNT
WTTCQSIAFPSKTSASIGSLCADARMYGVLPWNAFPGKVCGSNLLSICKTAEFQMTFHLF
IAAFVGAAATLVSLLTFMIAATYNFAVLKLMGRGTKF
NT seq 834 nt   +upstreamnt  +downstreamnt
atgggcttgttagagtgttgtgctagatgtctggtaggggccccctttgcttccctggtg
gccactggattgtgtttctttggagtggcactgttctgtggatgtggacatgaagctctc
actggtacagaaaagctaattgagacctatttctccaaaaactaccaggactatgagtat
ctcattaatgtgattcatgctttccagtatgtcatctatggaactgcctctttcttcttc
ctttatggggccctcctgctggctgagggcttctacaccaccggcgctgtcaggcagatc
tttggcgactacaagaccaccatctgcggcaagggcctgagcgcaacggtaacagggggc
cagaaggggaggggttccagaggccaacatcaagctcattctttggagcgggtgtgtcat
tgtttgggaaaatggctaggacatcccgacaagtttgtgggcatcacctatgccctgact
gttgtatggctcctggtgtttgcctgctcggctgtacctgtgtacatttacttcaatacc
tggaccacctgtcagtctattgccttccctagcaagacctctgccagtataggcagtctc
tgcgctgatgccagaatgtatggtgttctcccatggaatgctttccctggcaaggtttgt
ggctccaaccttctgtccatctgcaaaacagctgagttccaaatgaccttccacctgttt
attgctgcgtttgtgggtgctgcggccacactagtttccctgctcaccttcatgattgct
gccacttacaacttcgccgtccttaaactcatgggccgaggcaccaagttctga

DBGET integrated database retrieval system