KEGG   Mus musculus (mouse): 18830
Entry
18830             CDS       T01002                                 

Symbol
Pltp, Bpi, Bpife, OD10, OD107
Name
(RefSeq) phospholipid transfer protein
  KO
K08761  phospholipid transfer protein
Organism
mmu  Mus musculus (mouse)
Pathway
mmu03320  PPAR signaling pathway
mmu04979  Cholesterol metabolism
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09150 Organismal Systems
  09152 Endocrine system
   03320 PPAR signaling pathway
    18830 (Pltp)
  09154 Digestive system
   04979 Cholesterol metabolism
    18830 (Pltp)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:mmu02000]
    18830 (Pltp)
Transporters [BR:mmu02000]
 Other transporters
  Pores ion channels [TC:1]
   18830 (Pltp)
SSDB
Motif
Pfam: LBP_BPI_CETP_C LBP_BPI_CETP
Other DBs
NCBI-GeneID: 18830
NCBI-ProteinID: NP_035255
MGI: 103151
Ensembl: ENSMUSG00000017754
Vega: OTTMUSG00000001168
UniProt: P55065 Q3UFS5 Q3UE59
Position
2 H3; 2 85.27 cM
AA seq 493 aa
MVLLWALFLALLAGAHAELPGCKIRVTSAALDLVKQEGLRFLEQELETITIPDVYGAKGH
FYYNISDVRVTQLHLISSELHFQPDQDLLLNISNASLGLHFRRQLLYWFLYDGGYINASA
EGVSIRTGLQLSQDSSGRIKVSNVSCEASVSKMNMAFGGTFRRMYNFFSTFITSGMRFLL
NQQICPVLYHAGTVLLNSLLDTVPVRSSVDDLVGIDYSLLKDPVVSNGNLDMEFRGAFFP
LKEDNWSLPNRAVEPQLEDDERMVYVAFSEFFFDSAMESYFQAGALQLTLVGDKVPSDLD
MLLRATYFGSIVLLSPTVINSPLKLKLEATSPPRCTIKPSGTTISITASVTITLAPPMLP
EVELSKMIMEGRLSAKLTLRGKALRVKLDLRRFQIYSNQSALESLALIPLQAPLKTLLQI
GVMPLLNERTWRGVQIPLPEGINFVREVVTNHAGFVTVGADLHFAKGLREVIDKNRPADV
AASHVPPPSAAAA
NT seq 1482 nt   +upstreamnt  +downstreamnt
atggtcctgctctgggccctcttcctagcgctcctggcaggtgcccacgccgagctcccg
ggctgcaagatccgcgtcacctccgcggctctggatctggtgaagcaggaaggcctgcgc
tttctggaacaagagctggagaccatcaccatcccagacgtgtacggcgcaaagggccac
ttttactacaatatctcggacgtgagggtcacacagctgcacctgatatcctcggaactc
cacttccagccagaccaagatctgctgctgaacatctccaacgcatccttggggctgcac
ttccggaggcagctactctactggttcttatatgatgggggctacatcaatgcctcggcg
gagggtgtgtccatccgaacaggtctacagctctcccaggattccagtggtcggattaaa
gtgtccaatgtctcctgcgaggcctctgtgtctaaaatgaatatggccttcgggggaacc
ttcaggaggatgtataactttttctccacgttcatcacttctgggatgcggttcctcctc
aaccagcagatctgccctgtgctctaccatgctgggacggtgttgctcaactccctcctg
gacacagtgcccgtgcgcagttctgtggatgatctcgtgggcatcgattactcccttctg
aaggatcctgtggtctccaacggcaacctggatatggaattccggggagcattcttccct
ctgaaggaggacaactggagcctccccaacagggcggtggagcctcagctggaggacgac
gagaggatggtgtacgtggccttttccgagttcttctttgactctgccatggagagctac
ttccaggctggagcgctgcagctgacacttgttggggacaaggtgccgagtgacctggac
atgcttctgagggccacctactttgggagcattgttctcctgagtccgacagtgattaac
tccccactgaagctgaagctagaggccacgagccctccacgttgtaccatcaagccgtca
ggcaccaccatctccatcaccgccagcgtcaccatcaccttggccccgcccatgttgccc
gaagtggagctgtccaagatgatcatggaaggccgtctcagtgctaagttgacactccgg
ggcaaggcgctgcgagtgaagctggaccttcgaaggtttcaaatctactcaaatcagtct
gcgctggagtctctggcgctgatcccactgcaggccccactgaagacactgctgcaaatc
ggagtgatgcctttgctgaacgagcgtacctggcgtggggtgcagatcccccttcctgag
ggtatcaacttcgtgcgtgaggtggtgaccaaccacgcgggcttcgtcactgttggggct
gacctccactttgccaaagggcttcgagaagtgattgacaagaaccgtcctgcagacgtt
gcggcctcccatgtccccccaccctctgctgcagctgcctga

DBGET integrated database retrieval system