KEGG   Mus musculus (mouse): 18846Help
Entry
18846             CDS       T01002                                 

Gene name
Plxna3, PlexA3, Plxa3, Plxn3, Plxn4, SEX, mKIAA4078
Definition
(RefSeq) plexin A3
  KO
K06820  plexin A
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04360  Axon guidance
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09150 Organismal Systems
  09158 Development and regeneration
   04360 Axon guidance
    18846 (Plxna3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Plexin_cytopl Sema TIG TIG_2 TIG_plexin PSI
Motif
Other DBs
NCBI-GeneID: 18846
NCBI-ProteinID: NP_032909
MGI: 107683
Ensembl: ENSMUSG00000031398
Vega: OTTMUSG00000017689
UniProt: P70208 A0A158SIT4
Structure
PDB: 

Position
X A7.3; X 38.0 cM
AA seq 1872 aa AA seqDB search
MPTVCLLPLLFFTIGGCLGSSRPFRTFVVTDTTLTHLAVHRVTGEVFVGAVNRVFKLAPN
LTELRAHVTGPIEDNARCYPPPSMRVCSHRLVPVDNVNKLLLIDYAARRLVACGSIWQGI
CQFLRLDDLFKLGEPHHRKEHYLSGAQEPDSMAGVIVEQVQGPSKLFVGTAVDGKSEYFP
TLSSRKLIDDEDSGDMFSLVYQDEFVSSQIKIPSDTLSLYPAFDIYYIYGFVSASFVYFL
TLQLDTQQTLLDTAGEKFFTSKIVRMCAGDSEFYSYVEFPIGCSWRGVEYRLVQSAHLAK
PGLLLAQALGVPADEDVLFTIFSQGQKNRANPPRQTILCLFTLSSINAHIRRRIQSCYRG
EGTLALPWLLNKELPCINTPLQINGNFCGLVLNQPLGGLHVIEGLPLLADSTDGMASVAA
YTYHQHSVVFIGTRSGNLKKVRVDGSQDAQLYETVSVVQGSPILRDLLFSPDHRHIYLLS
EKQVSQLPVETCEQYLSCAACLGSGDPHCGWCVLQHRCCREGACPGASAPHGFAEELSKC
IQVRVRPNNVSVTSSGVQLTVAMRNVPDLSVGVSCSFEEVTESEAILLPSGELRCPSPSL
QELQTLTRGHGATHTVRLQLLSMETGVRFAGVDFVFYNCSALQSCMSCVGSPYPCHWCKY
RHVCTSHPHECSFQEGRVHSPEGCPEILPQGDLLIPVGVMQPLTLRAKNLPQPQSGQKNY
ECVVRVQGRQHRVPAVRFNSSSVQCQNASYFYEGDEFGDTELDFSVVWDGDFPIDKPPSF
RALLYKCWAQRPSCGLCLKADPRFNCGWCISEHRCQLRAHCPAPKSNWMHPSQKGARCSH
PRITQIHPLTGPKEGGTRVTIVGENLGLTSREVGLRVAGVRCNSIPTEYVSAERIVCEME
ESLVPSPPPGPAELCVGDCSADFRTQSQQLYSFVTPTFDRVSPSRGPASGGTRLTISGIS
LDAGSRVTVIIRDGECQFVRRDAEAIVCISPVSTLGPSQSPITLAIDHANISNTGVIYTY
TQDPTVTHLEPTWSIINGSTSITVSGTHLLTVQEPRVRAKYRGIETTNTCQVINDTAMLC
KAPGIFLGHPQPRAQGEHPDEFGFLLDHVQAARSLNRSSFTYYPDPSFEPLGPSGVLDVK
PGSHVVLKGKNLIPAAAGSSRLNYTVLIGGQPCALTVSDTQLLCDSPSQTGRQPVMVLVG
GLEFWLGTLHITADRALTLPAMVGLAAGGGLLLLAITVVLVAYKRKTQDADRTLKRLQLQ
MDNLESRVALECKEAFAELQTDINELTNHMDGVQIPFLDYRTYAVRVLFPGIEAHPVLKE
LDTPPNVEKALRLFGQLLHSRAFLLTFIHTLEAQSSFSMRDRGTVASLTMVALQSRLDYA
TGLLKQLLADLIEKNLESKNHPKLLLRRTESVAEKMLTNWFTFLLHKFLKECAGEPLFLL
YCAIKQQMEKGPIDAITGEARYSLSEDKLIRQQIDYKTLTLHCVCPESEGSAQVPVKVLN
CDSITQAKDKLLDTVYKGIPYSQRPKAEDMDLEWRQGRMARIILQDEDITTKIECDWKRV
NSLAHYQVTDGSLVALVPKQVSAYNMANSFTFTRSLSRYESLLRAASSPDSLRSRAPMLT
PDQEAGTKLWHLVRNHDHTDHREGDRGSKMVSEIYLTRLLATKGTLQKFVDDLFETVFST
AHRGSALPLAIKYMFDFLDEQADQRQISDPDVRHTWKSNCLPLRFWVNVIKNPQFVFDIH
KNSITDACLSVVAQTFMDSCSTSEHRLGKDSPSNKLLYAKDIPNYKSWVERYYRDIAKMA
SISDQDMDAYLVEQSRLHANDFNVLSALSELYFYVTKYRQEILTSLDRDASCRKHKLRQK
LEQIITLVSSSS
NT seq 5619 nt NT seq  +upstreamnt  +downstreamnt
atgcccactgtctgccttctcccattgctattcttcaccataggagggtgcctgggtagc
agcaggccatttcgtacctttgtggtaacagataccactctgactcacctggctgtgcac
cgagtgactggggaggtgtttgtaggtgccgtgaatcgagttttcaagctggctccaaac
ctaactgagctacgggcccatgtcacagggcccattgaggacaatgctcgctgctaccca
cctcctagcatgcgtgtgtgctcccaccgcctggtgcctgtggacaatgtgaacaagctg
ctcctcatagactatgcagcccgtcgtttggtagcttgtggcagcatctggcagggcatc
tgccagttcctgcgtctggatgacctcttcaagttgggtgagccccaccatcgcaaggag
cactatctgtcaggggcccaggagcctgattccatggctggcgtcattgttgaacaggtc
caggggcctagcaagttgtttgtgggcaccgctgttgatggcaagtctgagtactttccc
accttgagttcccgtaagctcatcgacgatgaggacagtggagatatgttcagtctggtg
taccaggatgagtttgtctcttctcagatcaagatcccttcagacacattgtccttgtac
cctgcctttgacatctactacatatatggctttgtcagtgcctccttcgtgtacttctta
acgttgcagctggacacccagcagacgctgttggatacagcaggcgagaaattcttcaca
tccaagatcgtgcgcatgtgtgcaggggactcagagttctactcttatgtagagttccct
attggctgctcctggcgtggtgtggagtaccgcttggtgcagagtgcccatctggccaag
ccaggcctgctattggcccaggctctgggtgtgccagccgacgaggatgtcctcttcacc
atcttctctcagggccagaagaacagagccaacccacctcggcagaccatcctttgcctt
ttcaccctcagcagcattaatgcccacatccggcgccgaatccaatcgtgctaccgtgga
gagggcacgctggccctaccctggctactgaataaggagctgccctgcatcaacacccct
ctgcagatcaatggaaacttctgtgggttagtgttgaatcaaccattgggtggcctacac
gtgattgaggggctacccttgctggctgacagcactgatggcatggccagtgtggctgcc
tacacctaccaccagcattctgtggttttcatcggtacacgcagcggtaatttgaagaag
gtgcgggtcgatggctctcaggatgcccagctatatgaaacggtctctgtggtgcagggc
agccccatacttcgagacctgctcttcagccctgaccaccgacacatctacctcctgagt
gagaagcaggtgagccaactcccggtggagacctgtgagcagtatctgagctgtgctgca
tgcctgggctcaggggacccacactgtggttggtgtgtgctacagcacaggtgctgccgt
gaaggggcctgtccaggtgcctctgccccacatggctttgcagaagagctgagcaaatgt
atacaggtgcgggtccgtcccaataatgtgtcagtgacatcctctggggtgcagctgacc
gtagccatgcgcaacgtgccagacctcagtgtgggtgtgagctgttcctttgaggaggtg
actgaaagtgaggctattctgctgccctctggagagttacgatgtccttcaccatccctt
caggagctccagacacttaccagagggcatggggccactcatactgtgcggcttcagctg
ctctccatggagactggtgtgaggtttgctggggttgactttgtcttctacaactgcagt
gccctccagtcgtgtatgtcctgtgttggcagcccttacccctgccactggtgtaagtac
cgtcatgtgtgtaccagccacccacacgagtgctctttccaggagggcagggtccacagc
cctgagggctgccctgagatcctgcctcaaggggacctcttgattcctgtgggtgtcatg
cagcctctaactctgcgggctaagaacctgccacagcctcagtccggacagaagaattat
gaatgcgtggtccgtgtacagggacggcaacatcgggtacctgcagtgcgctttaacagc
agcagtgtgcagtgccagaatgcctcgtacttctatgaaggtgatgagtttggtgacacc
gaactggacttctctgtggtttgggatggagatttccccattgataagcctcctagcttc
cgagcccttctttacaagtgctgggctcagcggcctagctgtggcctctgcctcaaggct
gatccccgattcaactgtggctggtgcatctcagagcacaggtgccagctgagggctcac
tgcccagctcccaaaagtaactggatgcacccaagccagaagggtgcccgatgcagccat
ccccgaatcacccagattcatccacttacaggacccaaggagggtggcacccgggtcacc
attgtgggtgagaacctgggcctcacttcccgtgaggttggccttcgagtagctggtgta
cgttgcaactccattcccaccgaatatgtcagtgctgaaaggatcgtatgtgagatggag
gaatcgctggtgcccagcccaccacctgggcctgctgagctctgtgtaggggattgttct
gctgacttccgcacacagtcccagcaactctacagctttgtgacccctacatttgaccgt
gtgagtccctctcggggcccagcttctggaggcactcggcttaccatctctggaatttct
ctggatgccggcagcagggtcacagtgattataagagatggcgagtgccagtttgtgagg
agagatgccgaggcaatcgtgtgtatctcacctgtctccaccctgggccccagtcagagc
cctatcacccttgccatcgatcatgccaacatctccaacactggagtcatctatacctac
acccaggaccctacggtcacacaccttgagcccacctggagcatcatcaatggaagcacc
tccatcactgtgagtggaacccatctgctgacagttcaagaaccccgtgtacgagccaag
taccgtggtattgagaccactaacacatgccaggtgatcaacgacactgcaatgctatgt
aaggcccctggcatcttccttgggcaccctcagcctcgggcccaaggcgagcaccctgac
gagtttggcttcttgctggaccacgtgcaggcagcccgctccctcaaccgttcttccttc
acctactaccctgatcccagctttgaaccacttgggccctctggtgtgctagatgtcaaa
cctggttcacatgttgtattgaagggcaagaacctgatccctgctgcagctggcagctcc
cgcctcaactacacagtgttgattggaggacagccatgtgcactaactgtctcagatact
caacttctgtgtgattccccaagccagacaggccggcagcctgttatggtgctggtgggt
ggcctggagttctggttgggcacgctgcacatcactgctgatcgggcactgaccttacca
gctatggtggggctagcagcagggggcgggctcttgctgctggccatcactgttgtgctg
gtcgcctacaagcgtaagactcaggatgcagaccgcacacttaagcggcttcagctacaa
atggacaacctggagtctcgtgtggccttggagtgcaaggaagcctttgctgagctgcag
actgatatcaatgaactgacaaaccacatggatggtgtccagatccccttcttggactac
cggacctatgctgtgcgcgtgcttttccctggcatcgaggctcacccagtgctcaaggag
ctggatactccccccaatgtggagaaggccctgcgtctatttggacagttgctgcacagc
cgtgccttcctgctcacctttatccacactttggaggcccagagtagtttctccatgcgt
gaccgtggtactgtggcctcactcaccatggtggccctgcagagccggcttgactatgcc
actgggctgctcaagcaactgctggctgacctcatagagaaaaaccttgagagcaagaac
cacccaaagctgctattgcgcaggacagagtcggtggctgagaagatgctcaccaactgg
ttcacattcctgctgcataagttcctgaaggagtgcgccggggagccactcttcctgctg
tactgcgccatcaagcagcagatggagaaaggtcctattgatgccataacaggcgaggcc
cgctactccttaagtgaggacaagctcatccggcagcagatcgactataagaccctgact
ctgcattgtgtgtgcccggagagcgagggcagtgcccaggtccctgtgaaggttcttaac
tgtgatagcatcacccaggccaaagacaagctgttggatactgtgtacaagggtattcca
tactctcagcgccccaaagctgaggacatggatttggaatggcgccagggccgcatggcc
cgaatcatcctccaagatgaggacatcactacaaagattgagtgtgactggaagagggtc
aactcattggcccactaccaggtgactgatggttctttagtagcactggtgcccaaacaa
gtgtctgcctataacatggccaactcgttcaccttcacccggtcacttagtcgctacgag
agcttgctccgtgctgccagcagcccggatagcctccgttcccgagcacctatgctcacg
cctgaccaggaggcaggtaccaagctgtggcacctggtgaggaaccacgaccacactgat
caccgagaaggagaccgcggcagcaagatggtctcagaaatatatctcacaaggctgctg
gccaccaagggcacgttgcagaagtttgtagatgacttgtttgaaactgtgttcagtaca
gcccaccggggctcagccttacccttggccatcaagtacatgtttgacttcctggatgaa
caggctgaccagcgccagatcagtgaccctgatgtgcgtcacacctggaagagcaactgc
ttacctctgcgtttctgggtgaatgtgatcaagaatccgcaatttgtgtttgacatccat
aagaatagcatcacagacgcctgtttgtcagtggtggcccagaccttcatggactcctgt
tctacatcagagcaccgcctgggcaaggactcaccttccaacaagctcctctatgccaag
gatattcccaattacaagagctgggtggagaggtactatcgagatatcgcaaagatggca
tccatcagtgaccaggacatggacgcctacttagtggagcagtcccgcctccatgctaat
gacttcaatgtcctaagtgcactcagcgagctctacttctatgtcaccaagtaccgtcag
gagatcctcacctcgctggaccgagatgcctcttgtcggaagcacaagcttcgacagaag
ctggagcagatcatcaccctggtgtccagcagcagctga

DBGET integrated database retrieval system