KEGG   Mus musculus (mouse): 18861
Entry
18861             CDS       T01002                                 

Gene name
Pms2, AW555130, Pmsl2
Definition
(RefSeq) PMS1 homolog2, mismatch repair system component
  KO
K10858  DNA mismatch repair protein PMS2
Organism
mmu  Mus musculus (mouse)
Pathway
mmu03430  Mismatch repair
mmu03460  Fanconi anemia pathway
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03430 Mismatch repair
    18861 (Pms2)
   03460 Fanconi anemia pathway
    18861 (Pms2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:mmu03400]
    18861 (Pms2)
DNA repair and recombination proteins [BR:mmu03400]
 Eukaryotic type
  SSBR (single strand breaks repair)
   MMR (mismatch excision repair)
    MutL homologs
     18861 (Pms2)
SSDB
Motif
Pfam: MutL_C DNA_mis_repair HATPase_c_3 HATPase_c
Other DBs
NCBI-GeneID: 18861
NCBI-ProteinID: NP_032912
MGI: 104288
Ensembl: ENSMUSG00000075569 ENSMUSG00000079109
Vega: OTTMUSG00000035941 OTTMUSG00000054938
UniProt: B9EJ22
Position
5 82.82 cM; 5 G2
AA seq 859 aa
MEQTEGVSTECAKAIKPIDGKSVHQICSGQVVLSLSTAVKELIENSVDAGATTIDLRLKD
YGVDLIEVSDNGCGVEEENFEGLALKHHTSKIQEFADLTQVETFGFRGEALSSLCALSDV
TISTCHGSASVGTRLVFDHNGKITQKTPYPRPKGTTVSVQHLFYTLPVRYKEFQRNIKKE
YAKMVQVLQAYCIISAGVRVSCTNQLGQGKRQPVVCTSGSSGMKENIGSVFGQKQLQSLI
PFVQLPPSDAVCEEYGLSTSRTPQNLFYVSGFISQCTHGAGRSATDRQFFFINQRPCDPA
KVSKLVNEVYHMYNRHQYPFVVLNVSVDSECVDINVTPDKRQILLQEEKLLLAVLKTSLI
GMFDSDANKLNVNQQPLLDVEGNLVKLHTAELEKPVPGKQDNSPSLKSTADEKRVASISR
LREAFSLHPTKEIKSRGPETAELTRSFPSEKRGVLSSYPSDVISYRGLRGSQDKLVSPTD
SPGDCMDREKIEKDSGLSSTSAGSEEGFSTPEVASSFSSDYNVSSPEDRPSQETINCGDL
DCRPPGTGQSLKPEDHGYQCKALPLARLSPTNAKRFKTEERPSNVNISQRLPGPQSTSAA
EVDVAIKMNKRIVLLEFSLSSLAKRMKQLQHLKAQNKHELSYRKFRAKICPGENQAAEDE
LRKEISKSMFAEMEILGQFNLGFIVTKLKEDLFLVDQHAADEKYNFEMLQQHTVLQAQRL
ITPQTLNLTAVNEAVLIENLEIFRKNGFDFVIDEDAPVTERAKLISLPTSKNWTFGPQDI
DELIFMLSDSPGVMCRPSRVRQMFASRACRKSVMIGTALNASEMKKLITHMGEMDHPWNC
PHGRPTMRHVANLDVISQN
NT seq 2580 nt   +upstreamnt  +downstreamnt
atggagcaaaccgaaggcgtgagtacagaatgtgctaaggccatcaagcctattgatggg
aagtcagtccatcaaatttgttctgggcaggtggtactcagtttaagcaccgctgtgaag
gagttgatagaaaatagtgtagatgctggtgctactactattgatctaaggcttaaagac
tatggggtggacctcattgaagtttcagacaatggatgtggggtagaagaagaaaacttt
gaaggtctagctctgaaacatcacacatctaagattcaagagtttgccgacctcacgcag
gttgaaacttttggctttcggggggaagctctgagctctctgtgtgcactaagtgatgtc
actatatctacctgccacgggtctgcaagcgttgggactcgactggtgtttgaccataat
gggaaaatcacccagaaaactccctacccccgacctaaaggaaccacagtcagtgtgcag
cacttattttatacactacccgtgcgttacaaagagtttcagaggaacattaaaaaggag
tatgccaaaatggtgcaggtcttacaggcgtactgtatcatctcagcaggcgtccgtgta
agctgcactaatcagctcggacaggggaagcggcagcctgtggtgtgcacaagcggcagc
tctggcatgaaggaaaatatcgggtctgtgtttggccagaagcagttgcaaagcctcatt
ccttttgttcagctgccccctagtgacgctgtgtgtgaagagtacggcctgagcacttcc
aggacgccacaaaaccttttctacgtttcgggcttcatttcacagtgcacgcacggcgcc
gggaggagtgcaacagacaggcagtttttcttcatcaatcagaggccctgtgacccagca
aaggtctctaagcttgtcaatgaggtttatcacatgtataaccggcatcagtacccattt
gtcgtccttaacgtttccgttgactcagaatgtgtggatattaatgtaactccagataaa
aggcaaattctactacaagaagagaagctattgctggccgttttaaagacctccttgata
ggaatgtttgacagtgatgcaaacaagcttaatgtcaaccagcagccactgctagatgtt
gaaggtaacttagtaaagctgcatactgcagaactagaaaagcctgtgccaggaaagcaa
gataactctccttcactgaagagcacagcagacgagaaaagggtagcatccatctccagg
ctgagagaggccttttctcttcatcctactaaagagatcaagtctaggggtccagagact
gctgaactgacacggagttttccaagtgagaaaaggggcgtgttatcctcttatccttca
gacgtcatctcttacagaggcctccgtggctcgcaggacaaattggtgagtcccacggac
agccctggtgactgtatggacagagagaaaatagaaaaagactcagggctcagcagcacc
tcagctggctctgaggaagggttcagcaccccagaagtggccagtagctttagcagtgac
tataacgtgagctccccagaagacagaccttctcaggaaaccataaactgtggtgacttg
gactgccgtcctccaggtacaggacagtccttgaagccagaagaccatggatatcaatgc
aaagctctacctctagctcgtctgtcacccacaaatgccaagcgcttcaagacagaggaa
agaccctcaaatgtcaacatttctcaaagattgcctggtcctcagagcacctcagcagct
gaggtcgatgtagccataaaaatgaataagagaatcgtgctcctcgagttctctctgagt
tctctagctaagcgaatgaagcagttacagcacctaaaggcgcagaacaaacatgaactg
agttacagaaaatttagggccaagatttgccctggagaaaaccaagcagcagaagatgaa
ctcagaaaagagattagtaaatcgatgtttgcagagatggagatcttgggtcagtttaac
ctgggatttatagtaaccaaactgaaagaggacctcttcctggtggaccagcatgctgcg
gatgagaagtacaactttgagatgctgcagcagcacacggtgctccaggcgcagaggctc
atcacaccccagactctgaacttaactgctgtcaatgaagctgtactgatagaaaatctg
gaaatattcagaaagaatggctttgactttgtcattgatgaggatgctccagtcactgaa
agggctaaattgatttccttaccaactagtaaaaactggacctttggaccccaagatata
gatgaactgatctttatgttaagtgacagccctggggtcatgtgccggccctcacgagtc
agacagatgtttgcttccagagcctgtcggaagtcagtgatgattggaacggcgctcaat
gcgagcgagatgaagaagctcatcacccacatgggtgagatggaccacccctggaactgc
ccccacggcaggccaaccatgaggcacgttgccaatctggatgtcatctctcagaactga

DBGET integrated database retrieval system