KEGG   Mus musculus (mouse): 18950
Entry
18950             CDS       T01002                                 

Gene name
Pnp, AL024301, AU015798, Np, Np-1, Np-2, Pnp1
Definition
(RefSeq) purine-nucleoside phosphorylase
  KO
K03783  purine-nucleoside phosphorylase [EC:2.4.2.1]
Organism
mmu  Mus musculus (mouse)
Pathway
mmu00230  Purine metabolism
mmu00240  Pyrimidine metabolism
mmu00760  Nicotinate and nicotinamide metabolism
mmu01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    18950 (Pnp)
   00240 Pyrimidine metabolism
    18950 (Pnp)
  09108 Metabolism of cofactors and vitamins
   00760 Nicotinate and nicotinamide metabolism
    18950 (Pnp)
Enzymes [BR:mmu01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.2  Pentosyltransferases
    2.4.2.1  purine-nucleoside phosphorylase
     18950 (Pnp)
SSDB
Motif
Pfam: PNP_UDP_1 UPF0227
Other DBs
NCBI-GeneID: 18950
NCBI-ProteinID: NP_038660
MGI: 97365
Ensembl: ENSMUSG00000115338
Vega: OTTMUSG00000032495
UniProt: P23492 Q543K9
Position
14 C1; 14 26.31 cM
AA seq 289 aa
MENEFTYEDYETTAKWLLQHTEYRPQVAVICGSGLGGLTAHLKEAQIFDYNEIPNFPQST
VQGHAGRLVFGLLNGRCCVMMQGRFHMYEGYSLSKVTFPVRVFHLLGVETLVVTNAAGGL
NPNFEVGDIMLIRDHINLPGFCGQNPLRGPNDERFGVRFPAMSDAYDRDMRQKAFSAWKQ
MGEQRKLQEGTYVMLAGPNFETVAESRLLKMLGADAVGMSTVPEVIVARHCGLRVFGFSL
ITNKVVMDYENLEKANHMEVLDAGKAAAQTLERFVSILMESIPLPDRGS
NT seq 870 nt   +upstreamnt  +downstreamnt
atggagaacgagttcacatacgaagattatgagaccactgccaagtggcttctgcaacac
actgaatatcgacctcaagtggcagtgatctgtggttccggcttaggagggctgactgct
cacttaaaggaggctcagatctttgactacaatgagatacccaactttccccaaagcaca
gtgcaaggtcacgcaggccgactggtgtttggattgctgaatggcagatgctgtgtgatg
atgcaaggccggttccatatgtatgaaggatactcactgtcaaaggtgacattcccagtg
agagttttccatcttctgggtgtggaaactttggtggtcaccaatgctgctggaggactc
aaccccaattttgaagttggagatattatgctgatccgtgatcacatcaacctacctggt
ttctgtggccagaaccctctccggggccccaacgatgaaaggtttggagttcgttttcct
gccatgtctgatgcttatgaccgggatatgaggcagaaggctttcagtgcctggaaacaa
atgggggagcaacgaaagctacaagaaggcacctacgtgatgttggcaggccccaacttt
gagactgtggcagagagtcgtctgctaaagatgctgggggcagatgctgttggcatgagc
acagtcccagaagttatcgtcgcaaggcactgtgggctccgtgtctttggtttctcactc
attacgaacaaggttgtcatggattatgagaacttggagaaggccaatcacatggaagtt
ctggatgccgggaaagcagctgcacagacattggaaaggtttgtctccattcttatggag
agcattccactcccggatcgtggcagctga

DBGET integrated database retrieval system