KEGG   Mus musculus (mouse): 18968
Entry
18968             CDS       T01002                                 

Gene name
Pola1, AW321876, Pola
Definition
(RefSeq) polymerase (DNA directed), alpha 1
  KO
K02320  DNA polymerase alpha subunit A [EC:2.7.7.7]
Organism
mmu  Mus musculus (mouse)
Pathway
mmu03030  DNA replication
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03030 DNA replication
    18968 (Pola1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:mmu03032]
    18968 (Pola1)
Enzymes [BR:mmu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.7  DNA-directed DNA polymerase
     18968 (Pola1)
DNA replication proteins [BR:mmu03032]
 Eukaryotic type
  DNA Replication Elongation Factors
   DNA polymerase alpha / primase complex
    18968 (Pola1)
SSDB
Motif
Pfam: DNA_pol_B DNA_pol_B_exo1 zf-DNA_Pol DNA_pol_alpha_N DUF1744 DNA_pol_B_2 rRNA_proc-arch
Other DBs
NCBI-GeneID: 18968
NCBI-ProteinID: NP_032918
MGI: 99660
Ensembl: ENSMUSG00000006678
Vega: OTTMUSG00000017971
UniProt: P33609 B9EHJ9
Position
X C3; X 41.06 cM
AA seq 1465 aa
MAPMHEEDCKLEASAVSDSGSFAASRARREKKSKKGRQEALERLKKAKAGEKYKYEVEDL
TSVYEEVDEEQYSKLVQARQDDDWIVDDDGIGYVEDGREIFDDDLEDDALDTCGKGSDGK
AHRKDRKDVKKPSVTKPNNIKAMFIASAGKKTTDKAVDLSKDDLLGDILQDLNTETAQIT
PPPVLIPKKKRSTGALLNPFSVHTPKAIPSGKPASPVLRNEPLLTPIPLKRAELAGELAQ
PECPEDEQELGVMEFEDGDFDESMDTEKVDEKPVTAKTWDQETEPVERVEHEADPERGTT
SYLENFLPDVSCWDIDQDDESIPQEVQVDSSNLPLVKGADDEQVFQFYWLDAYEDPYNQP
GVVFLFGKVWIESVKTHVSCCVMVKNIERTLYFLPREMKFDLNTGKETAIPVTMKDVYEE
FDSKISAKYKIMKFKSKIVEKNYAFEIPDVPEKSEYLEVRYSAEVPQLPQNLKGETFSHV
FGTNTSSLELFLMNRKIKGPCWLEVKNPQLLNQPISWCKFEVMALKPDLVNVIKDVSPPP
LVVMSFSMKTMQNVQNHQHEIIAMAALVHHSFALDKAPPEPPFQTHFCVVSKPKDCIFPC
DFKEVISKKNMKVEIAATERTLIGFFLAKVHKIDPDILVGHNICSFELEVLLQRINECKV
PYWSKIGRLRRSNMPKLGSRSGFGERNATCGRMICDVEISAKELIHCKSYHLSELVQQIL
KTERIVIPTENIRNMYSESSYLLYLLEHIWKDARFILQIMCELNVLPLALQITNIAGNIM
SRTLMGGRSERNEFLLLHAFYENNYIVPDKQIFRKPQQKLGDEDEEIDGDTNKYKKGRKK
ATYAGGLVLDPKVGFYDKFILLLDFNSLYPSIIQEFNICFTTVQRVTSEVQKATEDEEQE
QIPELPDPNLEMGILPREIRKLVERRKQVKQLMKQQDLNPDLVLQYDIRQKALKLTANSM
YGCLGFSYSRFYAKPLAALVTYKGREILMHTKDMVQKMNLEVIYGDTDSIMINTNSTNLE
EVFKLGNKVKSEVNKLYKLLEIDIDAVFKSLLLLKKKKYAALVVEPTSDGNYITKQELKG
LDIVRRDWCDLAKDTGNFVIGQILSDQSRDTIVENIQKRLIEIGENVLNGSVPVSQFEIN
KALTKDPQDYPDRKSLPHVHVALWINSQGGRKVKAGDTVSYVICQDGSNLTATQRAYAPE
QLQKLDNLAIDTQYYLAQQIHPVVARICEPIDGIDAVLIALWLGLDSTQFRVHQYHKDEE
NDALLGGPAQLTDEEKYKDCEKFKCLCPSCGTENIYDNVFEGSGLDMEPSLYRCSNVDCK
VSPLTFMVQLSNKLIMDIRRCIKKYYDGWLICEEPTCCSRLRRLPLHFSRNGPLCPVCMK
AVLRPEYSDKSLYTQLCFYRYIFDADCALEKLTEHEKDKLKKQFFPLRVLQDYRKVKNIA
EQFLSWSGYSEVNLSKLFANYAGKS
NT seq 4398 nt   +upstreamnt  +downstreamnt
atggcgcccatgcacgaagaggactgtaaactggaggcaagcgctgtgtcagattcaggg
agttttgcagcttcccgagctcggcgagaaaagaaatcaaagaaaggacgtcaagaagct
ttagagagactgaaaaaggctaaagctggggagaagtataaatacgaagttgaggacctc
acaagtgtttatgaagaagttgatgaagagcagtattcgaaactggttcaggcccgtcag
gatgatgactggattgtggatgacgatgggataggctatgtggaagatggcagagagatt
tttgatgatgaccttgaggatgatgcacttgacacctgtggaaaaggaagtgatggcaaa
gcacacagaaaggacaggaaggatgtaaagaaaccttcagtgacaaaaccaaacaatatc
aaggcaatgttcattgctagtgccgggaagaaaactacagataaagcagtagacttgtcc
aaggatgatctgctaggtgacattctacaggatctaaacactgagacagctcaaataact
ccaccacctgtattgataccaaagaaaaaaagatctactggggctttgctcaaccctttt
tcagtgcacacccctaaggcaattccttcaggaaaacctgcttcccctgtcctcaggaat
gagcctctgttaactcccattcctcttaaacgtgctgaacttgctggagagctggctcag
ccagaatgtccagaagatgagcaggagctaggggtaatggagtttgaagacggtgacttt
gatgagtccatggacacagagaaggtagatgagaagcctgtgactgctaagacttgggac
caagagactgagccagtagaaagggtggaacatgaggcagatcctgagaggggaaccaca
tcttacttagaaaattttctgccagatgtctcttgttgggacattgatcaggatgatgaa
agcatacctcaggaagttcaagtggattccagtaatctcccattggtaaaaggggcagat
gatgaacaagtgtttcagttttattggctggatgcttatgaagatccatacaaccaacca
ggtgtggtttttctgtttggcaaagtgtggattgaatcagtcaaaacccatgtgagctgt
tgtgttatggtgaaaaatattgagcgaacactctacttccttccccgtgaaatgaaattt
gacctaaacacagggaaagaaacagcaattccagttacaatgaaggatgtttatgaagaa
tttgattcaaaaatttcagcaaaatataaaataatgaagttcaagtccaagatagtggaa
aagaactatgcttttgagatacctgatgttccagaaaaatctgagtacctggaagttaga
tactcggcagaagtgccacagcttccacagaatttaaaaggagaaacattttctcatgtg
tttggaactaacacgtctagcttggaactgttcttgatgaataggaagatcaaaggacct
tgttggcttgaagtaaaaaatccacaactcttgaatcagccaatcagttggtgtaaattt
gaggtaatggctttgaaaccagacctggtgaatgtaattaaggatgtcagtcctcctcca
cttgtggtgatgtctttcagcatgaagacaatgcagaatgtacagaaccatcaacatgag
attattgctatggcggctttggttcatcacagttttgcattagataaagcacctccagag
cctccctttcagacacatttctgtgttgtgtctaaaccaaaggactgtattttcccatgt
gatttcaaagaagtgatttcgaaaaagaatatgaaggttgagatcgctgcaacagaaaga
accttgataggatttttccttgcaaaagttcacaaaattgaccctgacattcttgtgggt
cataatatttgtagttttgaactggaagtgctgctgcaaagaattaatgagtgcaaggtt
ccttactggtccaagataggtcggctgaggagatccaacatgccaaaacttgggagccgg
agtggatttggtgaaagaaatgctacctgtggccgaatgatatgtgatgtggaaatttca
gcaaaagaattgattcattgtaaaagctaccatttgtctgaacttgttcagcagattctg
aaaactgagaggattgtaattccaacagaaaatatacgaaacatgtatagtgaatcttct
tatctgttgtacctgttggaacatatctggaaagatgccagattcattttgcagatcatg
tgtgagctaaatgttcttccattagcattgcagatcactaacatcgctgggaacattatg
tctaggacactgatgggtggacgatctgagcgaaatgagtttttgttgcttcatgcattt
tatgaaaacaactatattgtgcctgacaagcagattttcagaaaacctcagcaaaaactg
ggagatgaagatgaggaaattgatggggacaccaataaatacaagaaagggcgtaagaaa
gcaacttacgctggaggcttggttttggaccccaaagttggtttttatgacaagttcatt
ttgctcctggatttcaacagtttatatccttccatcattcaggaatttaacatttgtttt
acaacagtgcaaagagttacttcagaggtgcagaaagctacagaggatgaggaacaagaa
cagatccctgagttgccagatccaaacttagagatgggcattttgcccagagagattcgg
aaactggtagagcggagaaaacaagtcaaacagctaatgaaacagcaagatttaaatcca
gaccttgttcttcagtatgacatccgacagaaggctttgaagctcacagcaaacagtatg
tatggttgcctgggattttcgtacagcagattttatgctaaaccactggctgccttggtg
acatacaaaggaagggagattttgatgcatacgaaagacatggtacagaagatgaatctt
gaagttatttatggagacacagattcaattatgataaataccaatagcaccaacctggaa
gaagtatttaagttgggaaacaaggtaaaaagtgaagtgaataaattgtacaaactgctt
gaaatagacattgatgctgttttcaagtctctgctgttgctgaagaaaaagaaatatgct
gctctagttgttgaaccaacatcagatgggaattacattaccaagcaggagctgaaagga
ttagatatagttagaagagactggtgtgatcttgccaaggacactggaaactttgtcatt
ggccagattctttctgatcaaagccgggacaccattgtggaaaacattcagaagaggtta
atagaaattggagaaaatgtgctaaatggcagtgtcccagtgagccagtttgaaattaac
aaggcattgacaaaggatccccaggattaccctgatagaaaaagcttacctcatgtacat
gttgcactgtggataaattctcaaggaggcaggaaggtgaaagctggtgatacggtgtcc
tatgttatttgtcaggatgggtcaaacctcactgcaactcagagggcctatgccccagaa
caattgcagaaacttgacaatttagccatcgacacccaatactacttggcccagcagatc
caccctgttgtggctcggatctgtgagccaatagatggaattgatgctgtactcattgca
ttatggctaggacttgactccactcaatttagagttcatcagtatcacaaagatgaagag
aatgatgccctccttggtggtccagcacagctaactgatgaagagaaatacaaggattgt
gaaaaattcaaatgcctttgtccttcatgtggaactgaaaatatttatgataatgtcttt
gaaggctcgggactggatatggaacccagtttgtatcgttgcagtaatgttgattgtaag
gtttcaccgttgaccttcatggtacagctgagcaacaaattgatcatggacattagacgg
tgcattaaaaagtactatgatggctggttgatatgtgaagagccaacttgttgcagtcgc
cttcgacgtcttccccttcatttctcccgaaatgggcctctgtgtccagtctgcatgaaa
gctgtgcttagaccagagtattctgacaagtccttgtacacccagctgtgcttttaccgg
tacatttttgatgcggactgtgcactggaaaaacttactgaacatgagaaagataaattg
aagaagcagtttttccctctccgagttcttcaggactacagaaaagtcaagaacatagca
gagcagttcttgtcctggagtggctactctgaagtgaacctcagcaagctcttcgccaat
tacgctgggaagtcctga

DBGET integrated database retrieval system