KEGG   Mus musculus (mouse): 18969
Entry
18969             CDS       T01002                                 

Gene name
Pola2, AI573378
Definition
(RefSeq) polymerase (DNA directed), alpha 2
  KO
K02321  DNA polymerase alpha subunit B
Organism
mmu  Mus musculus (mouse)
Pathway
mmu03030  DNA replication
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03030 DNA replication
    18969 (Pola2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:mmu03032]
    18969 (Pola2)
DNA replication proteins [BR:mmu03032]
 Eukaryotic type
  DNA Replication Elongation Factors
   DNA polymerase alpha / primase complex
    18969 (Pola2)
SSDB
Motif
Pfam: DNA_pol_E_B Pol_alpha_B_N
Other DBs
NCBI-GeneID: 18969
NCBI-ProteinID: NP_032919
MGI: 99690
Ensembl: ENSMUSG00000024833
UniProt: P33611
Position
19; 19 A
AA seq 600 aa
MAVSTQQLAEELQIFGLDYEDSLLEKLAELCVLYRQTEDGMVSELIAFCTSAGKTCLTVD
ILNSFEYEVLNKKLSKAWHSASKDSGHAGTRDIVSIQELIEAEEEEETLLSSYTTPSKGP
LKRVSSTPETPLTKRSVAARSPRQLLSPSSFSPSATPSQKYTSRTNRGEVVTTFGSAQGL
SWSGRGGSGSVSLKVVGDPEPLTGSYKAMFQQLMGVREVLTSKIEELGSELKEHHKIEAF
TPLLVPAQEPVILLGQIGCDSNGKLNSKSVILEGDQEHSYGAQIPVDLSELKEYSLFPGQ
VVIMEGFNTTGRRLTATKLYEGVPLPFYQPTEEEGASEQTMVVVACGPYTTSDSITYDPL
LDLIAIINRDQPDVCILFGPFLDAKHEQVENCKLTSPFEDVFKQCLRTVIEGTRSSGSHL
VFVPSLRDVHHEPVYPQPPFTFSELSREDKKRVQFVSEPCSLSINGVMFGLTSTDLLFHI
GAEEIFSSSGTSDRFSRVLKHILTQRSYYPLYPPHEDMAIDYENFYTYAQLPVTPDVFIV
PSELRYFVKDIFGCVCVNPGRLTKGQVGGTFGRLYLRRQPKAMDGGGRQGLSVAAQVVRI
NT seq 1803 nt   +upstreamnt  +downstreamnt
atggccgtgtccacccagcagctggcggaggaactacagatcttcggcctggactacgag
gactccctgttggagaaactggcagagctgtgtgttctataccgacagactgaggacggg
atggtcagtgagctcatcgccttctgcaccagtgcggggaagacatgccttactgtagac
atcctgaactcttttgaatacgaggttctgaacaaaaaactctccaaagcctggcacagt
gcctccaaagacagtgggcatgcaggaaccagagacattgtttctatacaagagctaatt
gaagcagaggaggaagaggagaccctcctaagctcttataccacaccctctaagggtcct
ctcaagcgagttagcagcaccccagaaacccccctaaccaaaaggagcgtcgctgctcgc
agcccacgtcagcttctctcaccgtcaagtttctccccgagtgctaccccctcccagaaa
tacacctccagaaccaaccggggagaagtggtgaccacctttggctccgcacagggcttg
tcttggtccgggagaggaggctctggaagcgtcagtctgaaggtcgtgggggacccagag
ccactcactggcagctacaaagcgatgtttcagcagctcatgggtgttcgagaagttctg
accagtaagatcgaagagctcggcagcgagctgaaggagcatcacaagatcgaggccttt
acccctctcctggtcccagcgcaagagcctgttattctcctgggtcagattggctgcgac
agcaacgggaagctgaacagcaagtccgtgattctcgagggggaccaggagcactcctat
ggcgcgcagatcccagtggacctatcggaactcaaagagtattccctcttccctggacag
gttgtaattatggaaggattcaacaccactggtaggagacttactgccaccaaactctat
gagggcgtgccacttccgttctatcagcctactgaagaggagggagcttctgagcagact
atggtggtagttgcctgcgggccttataccacctccgacagcatcacctatgaccccctg
cttgatctgatcgccatcatcaaccgtgaccagccagatgtctgcatcctgttcggacct
ttcctggatgctaaacatgaacaggtggagaactgtaagttgacaagcccattcgaagac
gttttcaagcaatgcctgagaacagttatcgaaggaacgagaagctccggctcccacctt
gtctttgtcccgtctctgagggatgtccatcatgagccagtatacccacagccgcctttc
accttctccgagctgtctcgagaggacaaaaagcgagtgcagtttgtgtcagagccctgc
agcctctccataaatggagtgatgtttggtttgacatccacggacctgctgttccacatc
ggggctgaggagatctttagctcttccgggacgtcagacagattcagccgagtccttaag
catatcctgacgcagagaagttactacccactttatccaccccacgaggacatggccata
gactacgagaacttctatacctatgcccagctgccggtcacccccgatgtcttcatagtg
ccgtccgagctgagatactttgtgaaggacatctttggctgtgtctgtgtgaatcctggg
cggctcaccaaaggacaagtgggcggcacctttggccgcctctacctcaggaggcagccc
aaggccatggacggtgggggcaggcagggcctgagcgtggcagcgcaggtggtcagaatc
tga

DBGET integrated database retrieval system