KEGG   Mus musculus (mouse): 18970Help
Entry
18970             CDS       T01002                                 

Gene name
Polb, A430088C08Rik
Definition
(RefSeq) polymerase (DNA directed), beta
  KO
K02330  DNA polymerase beta [EC:2.7.7.7 4.2.99.-]
Organism
mmu  Mus musculus (mouse)
Pathway
mmu03410  Base excision repair
mmu05166  Human T-cell leukemia virus 1 infection
mmu05203  Viral carcinogenesis
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03410 Base excision repair
    18970 (Polb)
 09160 Human Diseases
  09161 Cancer: overview
   05203 Viral carcinogenesis
    18970 (Polb)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    18970 (Polb)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:mmu03400]
    18970 (Polb)
Enzymes [BR:mmu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.7  DNA-directed DNA polymerase
     18970 (Polb)
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.99  Other carbon-oxygen lyases
    4.2.99.-  
     18970 (Polb)
DNA repair and recombination proteins [BR:mmu03400]
 Eukaryotic Type
  SSBR (single strand breaks repair)
   BER (base exicision repair)
    Short Patch-BER factors
     18970 (Polb)
  DSBR (double strand breaks repair)
   NHEJ (non-homologous end-joining)
    X-family DNA polymerases
     18970 (Polb)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DNA_pol_B_palm DNA_pol_lambd_f HHH_8 DNA_pol_B_thumb HHH_5 Cdd1 HHH HHH_2 NTP_transf_2
Motif
Other DBs
NCBI-GeneID: 18970
NCBI-ProteinID: NP_035260
MGI: 97740
Ensembl: ENSMUSG00000031536
Vega: OTTMUSG00000060893
UniProt: Q8K409
Position
8 A2; 8 11.42 cM
AA seq 335 aa AA seqDB search
MSKRKAPQETLNGGITDMLVELANFEKNVSQAIHKYNAYRKAASVIAKYPHKIKSGAEAK
KLPGVGTKIAEKIDEFLATGKLRKLEKIRQDDTSSSINFLTRVTGIGPSAARKFVDEGIK
TLEDLRKNEDKLNHHQRIGLKYFEDFEKRIPREEMLQMQDIVLNEIKKVDSEYIATVCGS
FRRGAESSGDMDVLLTHPNFTSESSKQPKLLHRVVEQLQKVHFITDTLSKGETKFMGVCQ
LPSEKDGKEYPHRRIDIRLIPKDQYYCGVLYFTGSDIFNKNMRAHALEKGFTINEYTIRP
LGVTGVAGEPLPVDSEQDIFDYIQWRYREPKDRSE
NT seq 1008 nt NT seq  +upstreamnt  +downstreamnt
atgagcaaacgcaaggcgccgcaggagaccctcaacggcggcatcacggacatgctcgtg
gaactcgcaaactttgagaagaacgtgagccaggcgatccacaagtacaatgcgtacaga
aaagcggcatctgtgatagccaagtacccacacaaaatcaagagcggagcggaagctaag
aaactgccaggagtaggaacaaaaattgctgaaaagattgatgaatttttagcaactgga
aaattgcgtaaactggaaaagattcgtcaagatgatacaagttcatccatcaatttcctg
actcgagttactggcattggaccatctgctgcaaggaagtttgtagatgaaggaattaag
acattagaagatctcaggaaaaatgaagataaactgaaccatcatcaacgaattgggctg
aaatatttcgaggactttgaaaagagaattcctcgtgaggaaatgctgcagatgcaggat
attgtacttaatgaaattaaaaaagtggactctgagtacattgctacagtctgtggcagt
ttcagaagaggcgcagagtcgagtggagacatggatgtcctgctgacccacccaaacttc
acgtcagaatccagcaaacagccaaagttgttacatcgtgttgtggaacagttacaaaaa
gtccatttcattacagatactctgtcaaagggtgaaacaaagttcatgggtgtttgccag
cttcccagcgagaaggatggaaaggaatatccacacaggagaatcgatatcaggttgatc
cccaaagatcagtactactgtggtgttctctacttcactgggagtgacatctttaataag
aacatgagagcgcacgccctggaaaagggcttcacaatcaatgagtacaccatccgcccc
ctgggggtcactggagtcgctggggagccccttcctgtggacagtgagcaggacattttt
gattacatccagtggcgctaccgggagcccaaggatagaagtgaatga

DBGET integrated database retrieval system