KEGG   Mus musculus (mouse): 18971
Entry
18971             CDS       T01002                                 

Gene name
Pold1, 125kD, 125kDa
Definition
(RefSeq) polymerase (DNA directed), delta 1, catalytic subunit
  KO
K02327  DNA polymerase delta subunit 1 [EC:2.7.7.7]
Organism
mmu  Mus musculus (mouse)
Pathway
mmu03030  DNA replication
mmu03410  Base excision repair
mmu03420  Nucleotide excision repair
mmu03430  Mismatch repair
mmu03440  Homologous recombination
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03030 DNA replication
    18971 (Pold1)
   03410 Base excision repair
    18971 (Pold1)
   03420 Nucleotide excision repair
    18971 (Pold1)
   03430 Mismatch repair
    18971 (Pold1)
   03440 Homologous recombination
    18971 (Pold1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:mmu03032]
    18971 (Pold1)
   03400 DNA repair and recombination proteins [BR:mmu03400]
    18971 (Pold1)
Enzymes [BR:mmu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.7  DNA-directed DNA polymerase
     18971 (Pold1)
DNA replication proteins [BR:mmu03032]
 Eukaryotic type
  DNA Replication Elongation Factors
   DNA polymerase delta complex
    18971 (Pold1)
DNA repair and recombination proteins [BR:mmu03400]
 Eukaryotic type
  SSBR (single strand breaks repair)
   BER (base exicision repair)
    Long Patch-BER factors
     DNA polymerase delta complex
      18971 (Pold1)
   MMR (mismatch excision repair)
    DNA polymerase delta complex
     18971 (Pold1)
SSDB
Motif
Pfam: DNA_pol_B DNA_pol_B_exo1 zf-C4pol DNA_pol_B_2
Other DBs
NCBI-GeneID: 18971
NCBI-ProteinID: NP_035261
MGI: 97741
Ensembl: ENSMUSG00000038644
Vega: OTTMUSG00000028995
UniProt: P52431
Position
7 B3; 7 28.83 cM
AA seq 1105 aa
MDCKRRQGPGPGVPPKRARGHLWDEDEPSPSQFEANLALLEEIEAENRLQEAEEELQLPP
EGTVGGQFSTADIDPRWRRPTLRALDPSTEPLIFQQLEIDHYVGSAPPLPEGPLPSRNSV
PILRAFGVTDEGFSVCCHIQGFAPYFYTPAPPGFGAEHLSELQQELNAAISRDQRGGKEL
SGPAVLAIELCSRESMFGYHGHGPSPFLRITLALPRLMAPARRLLEQGVRVPGLGTPSFA
PYEANVDFEIRFMVDADIVGCNWLELPAGKYVRRAEKKATLCQLEVDVLWSDVISHPPEG
QWQRIAPLRVLSFDIECAGRKGIFPEPERDPVIQICSLGLRWGEPEPFLRLALTLRPCAP
ILGAKVQSYEREEDLLQAWADFILAMDPDVITGYNIQNFDLPYLISRAQALKVDRFPFLG
RVTGLRSNIRDSSFQSRQVGRRDSKVISMVGRVQMDMLQVLLREHKLRSYTLNAVSFHFL
GEQKEDVQHSIITDLQNGNEQTRRRLAVYCLKDAFLPLRLLERLMVLVNNVEMARVTGVP
LGYLLTRGQQVKVVSQLLRQAMRQGLLMPVVKTEGSEDYTGATVIEPLKGYYDVPIATLD
FSSLYPSIMMAHNLCYTTLLRPGAAQKLGLKPDEFIKTPTGDEFVKSSVRKGLLPQILEN
LLSARKRAKAELAQETDPLRRQVLDGRQLALKVSANSVYGFTGAQVGKLPCLEISQSVTG
FGRQMIEKTKQLVESKYTVENGYDANAKVVYGDTDSVMCRFGVSSVAEAMSLGREAANWV
SSHFPSPIRLEFEKVYFPYLLISKKRYAGLLFSSRSDAHDKMDCKGLEAVRRDNCPLVAN
LVTSSLRRILVDRDPDGAVAHAKDVISDLLCNRIDISQLVITKELTRAAADYAGKQAHVE
LAERMRKRDPGSAPSLGDRVPYVIIGAAKGVAAYMKSEDPLFVLEHSLPIDTQYYLEQQL
AKPLLRIFEPILGEGRAESVLLRGDHTRCKTVLTSKVGGLLAFTKRRNCCIGCRSVIDHQ
GAVCKFCQPRESELYQKEVSHLNALEERFSRLWTQCQRCQGSLHEDVICTSRDCPIFYMR
KKVRKDLEDQERLLQRFGPPGPEAW
NT seq 3318 nt   +upstreamnt  +downstreamnt
atggattgtaagcggcgacaaggaccaggccctggggtgcccccaaagcgggctcgaggg
cacctctgggatgaggacgagccttcgccgtcgcagtttgaggcgaacctggcactgctg
gaggaaatagaggctgagaaccggctgcaggaggcagaggaggagctgcagctgccccca
gagggcaccgtgggtgggcagttttccactgcagacattgaccctcggtggcggcggccc
accctacgtgccctggaccccagcacggagcccctcatcttccagcagctggagattgac
cactatgtgggctcagcaccacccctgccagaagggcccctgccatcccggaactcagtg
cccatactgagggcctttggggtcaccgatgaaggcttctccgtctgctgccacatacag
ggctttgccccctacttctacacccccgcgcctcctggttttggggccgagcacctgagt
gagctgcagcaggagctgaacgcagccatcagccgggaccagcgcggtgggaaggagctc
tcagggccggcagtgctggcaatagagctatgctcccgtgagagcatgtttgggtaccac
ggtcatggcccttctccatttctccgcatcaccctggcactaccccgccttatggcacca
gcccgccgccttctggaacagggtgtccgagtgccaggcctgggcaccccgagcttcgca
ccctacgaagccaacgtggactttgagatccggttcatggtggatgctgacattgtggga
tgcaactggttggagctgccagctggaaagtacgttcggagggcggagaagaaggccacc
ctgtgtcagctggaggtggacgtgctgtggtcagatgtgatcagtcacccaccggagggg
cagtggcagcgcattgcacccctgcgtgtgcttagcttcgacatcgagtgtgctggccga
aaaggcatcttccctgagcctgagcgtgaccccgtgatccagatctgttctctggggctg
cgctggggggagccggagccattcttgcgtctggcactcacgctgcggccctgtgccccc
atcctgggtgccaaagtgcagagctatgagcgggaagaagacctgctccaggcctgggcc
gacttcatccttgccatggaccctgacgtgatcaccggctacaacattcagaactttgac
ctcccatacctcatctctcgggcacaggccctaaaggtggaccgcttccctttcctgggc
cgcgtgactggtctccgctccaacatccgtgactcctccttccaatcaaggcaggtcggc
cggcgggacagtaaggtgatcagcatggtgggtcgcgttcagatggatatgctgcaggtg
ctgcttcgggaacacaagctccgctcctacacgctcaacgctgtgagtttccacttcctg
ggcgagcagaaggaggacgttcagcacagcatcatcaccgacctgcagaatgggaacgaa
cagacgcgccgccgcctggccgtgtactgcctgaaggacgcctttctgccactccgacta
ctagagcgccttatggtgctggtgaataatgtggagatggcgcgtgtcacgggtgtaccc
cttgggtacctgctcacccggggccagcaggtcaaggtcgtgtctcagctgctgcgccag
gccatgcgccaggggctgctgatgcctgtggtgaagaccgagggcagtgaggactacacg
ggagccacagtcattgagcccctcaaagggtactatgacgtccccattgccaccctggac
ttctcctccttgtacccatccatcatgatggcccataatctgtgctacaccacgctgctc
cgacctggggctgcccagaagctgggccttaaaccagatgagttcatcaagacacccact
ggggatgagtttgtgaagtcatctgtacggaagggcctcctgccccagatcctggagaat
ctgctgagtgcccgcaagagggccaaggctgagctggctcaggagacggaccccctgcgg
cgacaggtcttggacggccggcaactggcactaaaagtgagtgccaactccgtatatggc
ttcactggtgcccaggtgggcaagctgccatgtttggagatctcccagagtgtcactggg
ttcgggcggcagatgattgagaaaaccaagcagcttgtggagtccaagtacaccgtggaa
aatggctacgatgccaacgccaaggtagtctacggtgacacggactctgtgatgtgccgg
tttggcgtctcctctgtggctgaagcaatgtctctggggcgggaggctgcaaactgggta
tccagtcacttcccatcacccatccggctggagttcgagaaggtttacttcccatacctg
ctcatcagcaagaagcgctatgctggcctgctcttctcctcccgctctgatgcccatgac
aaaatggactgcaagggcctggaggctgtgcgcagggacaactgtcccctggtggccaac
ctcgttacatcctctctgcgccggatcctcgtggaccgggaccctgatggggcagtagcc
catgccaaggacgtcatctcggacctgctgtgcaaccgcatagacatctcccagctggtc
atcaccaaagagttgacccgcgcagcagcagactatgctggcaagcaggctcacgtggag
ctggctgagaggatgaggaagcgcgaccccggcagtgcgcccagcctgggtgaccgagtc
ccctatgtgatcattggtgctgctaagggtgtggccgcctacatgaagtcggaggacccc
ctgtttgtgctggagcacagcctgcccatcgacactcagtactacctggagcagcagctg
gccaagccgctcttgcgcatctttgagcccatcctgggtgagggccgtgcagagtctgtg
ctgctgcgcggtgaccacacacgatgcaagactgtgctcaccagcaaggtgggcggcctc
ttggccttcaccaagcgccgcaactgttgcattggctgccgctccgtaatcgaccatcaa
ggagccgtgtgtaagttctgtcagccacgggagtcggagctctatcagaaggaggtgtca
cacctgaatgccttggaagaacggttctctcgcctctggacacagtgtcaacgctgccag
ggcagcttgcatgaggacgtcatctgtaccagccgtgactgtcccatcttctacatgcgc
aagaaggtgcgcaaggacctggaagaccaggaacggctgctgcagcgctttggaccgccc
ggccctgaggcctggtga

DBGET integrated database retrieval system