KEGG   Mus musculus (mouse): 18971
Entry
18971             CDS       T01002                                 

Gene name
Pold1, 125kD, 125kDa
Definition
(RefSeq) polymerase (DNA directed), delta 1, catalytic subunit
  KO
K02327  DNA polymerase delta subunit 1 [EC:2.7.7.7]
Organism
mmu  Mus musculus (mouse)
Pathway
mmu03030  DNA replication
mmu03410  Base excision repair
mmu03420  Nucleotide excision repair
mmu03430  Mismatch repair
mmu03440  Homologous recombination
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03030 DNA replication
    18971 (Pold1)
   03410 Base excision repair
    18971 (Pold1)
   03420 Nucleotide excision repair
    18971 (Pold1)
   03430 Mismatch repair
    18971 (Pold1)
   03440 Homologous recombination
    18971 (Pold1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:mmu03032]
    18971 (Pold1)
   03400 DNA repair and recombination proteins [BR:mmu03400]
    18971 (Pold1)
Enzymes [BR:mmu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.7  DNA-directed DNA polymerase
     18971 (Pold1)
DNA replication proteins [BR:mmu03032]
 Eukaryotic type
  DNA Replication Elongation Factors
   DNA polymerase delta complex
    18971 (Pold1)
DNA repair and recombination proteins [BR:mmu03400]
 Eukaryotic type
  SSBR (single strand breaks repair)
   BER (base exicision repair)
    Long Patch-BER factors
     DNA polymerase delta complex
      18971 (Pold1)
   MMR (mismatch excision repair)
    DNA polymerase delta complex
     18971 (Pold1)
SSDB
Motif
Pfam: DNA_pol_B DNA_pol_B_exo1 zf-C4pol DNA_pol_B_2
Other DBs
NCBI-GeneID: 18971
NCBI-ProteinID: NP_035261
MGI: 97741
Ensembl: ENSMUSG00000038644
Vega: OTTMUSG00000028995
UniProt: P52431
Position
7 B3; 7 28.83 cM
AA seq 1105 aa
MDCKRRQGPGPGVPPKRARGHLWDEDEPSPSQFEANLALLEEIEAENRLQEAEEELQLPP
EGTVGGQFSTADIDPRWRRPTLRALDPSTEPLIFQQLEIDHYVGSAPPLPEGPLPSRNSV
PILRAFGVTDEGFSVCCHIQGFAPYFYTPAPPGFGAEHLSELQQELNAAISRDQRGGKEL
SGPAVLAIELCSRESMFGYHGHGPSPFLRITLALPRLMAPARRLLEQGVRVPGLGTPSFA
PYEANVDFEIRFMVDADIVGCNWLELPAGKYVRRAEKKATLCQLEVDVLWSDVISHPPEG
QWQRIAPLRVLSFDIECAGRKGIFPEPERDPVIQICSLGLRWGEPEPFLRLALTLRPCAP
ILGAKVQSYEREEDLLQAWADFILAMDPDVITGYNIQNFDLPYLISRAQALKVDRFPFLG
RVTGLRSNIRDSSFQSRQVGRRDSKVISMVGRVQMDMLQVLLREHKLRSYTLNAVSFHFL
GEQKEDVQHSIITDLQNGNEQTRRRLAVYCLKDAFLPLRLLERLMVLVNNVEMARVTGVP
LGYLLTRGQQVKVVSQLLRQAMRQGLLMPVVKTEGSEDYTGATVIEPLKGYYDVPIATLD
FSSLYPSIMMAHNLCYTTLLRPGAAQKLGLKPDEFIKTPTGDEFVKSSVRKGLLPQILEN
LLSARKRAKAELAQETDPLRRQVLDGRQLALKVSANSVYGFTGAQVGKLPCLEISQSVTG
FGRQMIEKTKQLVESKYTVENGYDANAKVVYGDTDSVMCRFGVSSVAEAMSLGREAANWV
SSHFPSPIRLEFEKVYFPYLLISKKRYAGLLFSSRSDAHDKMDCKGLEAVRRDNCPLVAN
LVTSSLRRILVDRDPDGAVAHAKDVISDLLCNRIDISQLVITKELTRAAADYAGKQAHVE
LAERMRKRDPGSAPSLGDRVPYVIIGAAKGVAAYMKSEDPLFVLEHSLPIDTQYYLEQQL
AKPLLRIFEPILGEGRAESVLLRGDHTRCKTVLTSKVGGLLAFTKRRNCCIGCRSVIDHQ
GAVCKFCQPRESELYQKEVSHLNALEERFSRLWTQCQRCQGSLHEDVICTSRDCPIFYMR
KKVRKDLEDQERLLQRFGPPGPEAW
NT seq 3318 nt   +upstreamnt  +downstreamnt
atggattgtaagcggcgacaaggaccaggccctggggtgcccccaaagcgggctcgaggg
cacctctgggatgaggacgagccttcgccgtcgcagtttgaggcgaacctggcactgctg
gaggaaatagaggctgagaaccggctgcaggaggcagaggaggagctgcagctgccccca
gagggcaccgtgggtgggcagttttccactgcagacattgaccctcggtggcggcggccc
accctacgtgccctggaccccagcacggagcccctcatcttccagcagctggagattgac
cactatgtgggctcagcaccacccctgccagaagggcccctgccatcccggaactcagtg
cccatactgagggcctttggggtcaccgatgaaggcttctccgtctgctgccacatacag
ggctttgccccctacttctacacccccgcgcctcctggttttggggccgagcacctgagt
gagctgcagcaggagctgaacgcagccatcagccgggaccagcgcggtgggaaggagctc
tcagggccggcagtgctggcaatagagctatgctcccgtgagagcatgtttgggtaccac
ggtcatggcccttctccatttctccgcatcaccctggcactaccccgccttatggcacca
gcccgccgccttctggaacagggtgtccgagtgccaggcctgggcaccccgagcttcgca
ccctacgaagccaacgtggactttgagatccggttcatggtggatgctgacattgtggga
tgcaactggttggagctgccagctggaaagtacgttcggagggcggagaagaaggccacc
ctgtgtcagctggaggtggacgtgctgtggtcagatgtgatcagtcacccaccggagggg
cagtggcagcgcattgcacccctgcgtgtgcttagcttcgacatcgagtgtgctggccga
aaaggcatcttccctgagcctgagcgtgaccccgtgatccagatctgttctctggggctg
cgctggggggagccggagccattcttgcgtctggcactcacgctgcggccctgtgccccc
atcctgggtgccaaagtgcagagctatgagcgggaagaagacctgctccaggcctgggcc
gacttcatccttgccatggaccctgacgtgatcaccggctacaacattcagaactttgac
ctcccatacctcatctctcgggcacaggccctaaaggtggaccgcttccctttcctgggc
cgcgtgactggtctccgctccaacatccgtgactcctccttccaatcaaggcaggtcggc
cggcgggacagtaaggtgatcagcatggtgggtcgcgttcagatggatatgctgcaggtg
ctgcttcgggaacacaagctccgctcctacacgctcaacgctgtgagtttccacttcctg
ggcgagcagaaggaggacgttcagcacagcatcatcaccgacctgcagaatgggaacgaa
cagacgcgccgccgcctggccgtgtactgcctgaaggacgcctttctgccactccgacta
ctagagcgccttatggtgctggtgaataatgtggagatggcgcgtgtcacgggtgtaccc
cttgggtacctgctcacccggggccagcaggtcaaggtcgtgtctcagctgctgcgccag
gccatgcgccaggggctgctgatgcctgtggtgaagaccgagggcagtgaggactacacg
ggagccacagtcattgagcccctcaaagggtactatgacgtccccattgccaccctggac
ttctcctccttgtacccatccatcatgatggcccataatctgtgctacaccacgctgctc
cgacctggggctgcccagaagctgggccttaaaccagatgagttcatcaagacacccact
ggggatgagtttgtgaagtcatctgtacggaagggcctcctgccccagatcctggagaat
ctgctgagtgcccgcaagagggccaaggctgagctggctcaggagacggaccccctgcgg
cgacaggtcttggacggccggcaactggcactaaaagtgagtgccaactccgtatatggc
ttcactggtgcccaggtgggcaagctgccatgtttggagatctcccagagtgtcactggg
ttcgggcggcagatgattgagaaaaccaagcagcttgtggagtccaagtacaccgtggaa
aatggctacgatgccaacgccaaggtagtctacggtgacacggactctgtgatgtgccgg
tttggcgtctcctctgtggctgaagcaatgtctctggggcgggaggctgcaaactgggta
tccagtcacttcccatcacccatccggctggagttcgagaaggtttacttcccatacctg
ctcatcagcaagaagcgctatgctggcctgctcttctcctcccgctctgatgcccatgac
aaaatggactgcaagggcctggaggctgtgcgcagggacaactgtcccctggtggccaac
ctcgttacatcctctctgcgccggatcctcgtggaccgggaccctgatggggcagtagcc
catgccaaggacgtcatctcggacctgctgtgcaaccgcatagacatctcccagctggtc
atcaccaaagagttgacccgcgcagcagcagactatgctggcaagcaggctcacgtggag
ctggctgagaggatgaggaagcgcgaccccggcagtgcgcccagcctgggtgaccgagtc
ccctatgtgatcattggtgctgctaagggtgtggccgcctacatgaagtcggaggacccc
ctgtttgtgctggagcacagcctgcccatcgacactcagtactacctggagcagcagctg
gccaagccgctcttgcgcatctttgagcccatcctgggtgagggccgtgcagagtctgtg
ctgctgcgcggtgaccacacacgatgcaagactgtgctcaccagcaaggtgggcggcctc
ttggccttcaccaagcgccgcaactgttgcattggctgccgctccgtaatcgaccatcaa
ggagccgtgtgtaagttctgtcagccacgggagtcggagctctatcagaaggaggtgtca
cacctgaatgccttggaagaacggttctctcgcctctggacacagtgtcaacgctgccag
ggcagcttgcatgaggacgtcatctgtaccagccgtgactgtcccatcttctacatgcgc
aagaaggtgcgcaaggacctggaagaccaggaacggctgctgcagcgctttggaccgccc
ggccctgaggcctggtga

KEGG   Mus musculus (mouse): 18972
Entry
18972             CDS       T01002                                 

Gene name
Pold2, 50kD, 50kDa, p5, p50, po1, po1D2
Definition
(RefSeq) polymerase (DNA directed), delta 2, regulatory subunit
  KO
K02328  DNA polymerase delta subunit 2
Organism
mmu  Mus musculus (mouse)
Pathway
mmu03030  DNA replication
mmu03410  Base excision repair
mmu03420  Nucleotide excision repair
mmu03430  Mismatch repair
mmu03440  Homologous recombination
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03030 DNA replication
    18972 (Pold2)
   03410 Base excision repair
    18972 (Pold2)
   03420 Nucleotide excision repair
    18972 (Pold2)
   03430 Mismatch repair
    18972 (Pold2)
   03440 Homologous recombination
    18972 (Pold2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:mmu03032]
    18972 (Pold2)
   03400 DNA repair and recombination proteins [BR:mmu03400]
    18972 (Pold2)
DNA replication proteins [BR:mmu03032]
 Eukaryotic type
  DNA Replication Elongation Factors
   DNA polymerase delta complex
    18972 (Pold2)
DNA repair and recombination proteins [BR:mmu03400]
 Eukaryotic type
  SSBR (single strand breaks repair)
   BER (base exicision repair)
    Long Patch-BER factors
     DNA polymerase delta complex
      18972 (Pold2)
   MMR (mismatch excision repair)
    DNA polymerase delta complex
     18972 (Pold2)
SSDB
Motif
Pfam: DNA_pol_E_B DNA_pol_D_N
Other DBs
NCBI-GeneID: 18972
NCBI-ProteinID: NP_032920
MGI: 1097163
Ensembl: ENSMUSG00000020471
Vega: OTTMUSG00000005094
UniProt: O35654
Position
11; 11 A1
AA seq 469 aa
MFSEQAAQRAHTLLAPPSASNATFARVPVATYTNSSQPFRLGERSFNRQYAHIYATRLIQ
MRPFLVSRAQQHWGSRVEVKKLCELQPGEQCCVVGTLFKAMSLQPSILREISEEHNLVPQ
PPRSKYIHPDDELVLEDELQRIKLKGTIDVSKLVTGTVLAVLGSAKDDGRFQVEDHCFAD
LAPQKPVPPLDTDRFVLLVSGLGLGGGGGESLLGTQLLVDVVTGQLGDEGEQCSAAHVSR
VILAGNLLSHNTQSRDSINKAKYLTKKTQAASVEAVKMLDEILLQLSASVPVDVMPGEFD
PTNYTLPQQPLHPCMFPLATAYSTLQLVTNPYQATIDGVRFLGTSGQNVSDIFRYSSMED
HLEILEWTLRVRHISPTAPDTLGCYPFYKTDPFIFPECPHVYFCGNTPSFGSKIIRGPED
QVVLLVAVPDFSSTQTACLVNLRSLACQPISFAGFGAEQEDLEGLGLGP
NT seq 1410 nt   +upstreamnt  +downstreamnt
atgttctccgagcaggcagcacagagggcccacactctgctcgccccgccctctgccagc
aatgccacctttgcccgggtacctgtggcaacttacaccaactcctcacagcccttccga
ctgggagagcgcagctttaaccggcagtacgcccatatttatgccacccgcctcatccag
atgagaccgttcctggtgagccgggcgcagcaacactggggcagccgagttgaagtgaag
aagttgtgtgagctgcagcctggggagcagtgctgtgtggtgggcacgctgttcaaagcc
atgtccctccaaccctccatcctgcgggagatcagcgaggagcacaacctggtcccccag
cctccacggagcaaatatatccacccggatgacgagctggtcttagaagatgagctgcag
cgtatcaaactgaaaggcaccattgatgtgtcaaagctggtcacaggaacggtcttggcc
gtgttgggctctgcgaaagatgacgggaggtttcaggttgaagaccactgctttgctgac
ctggctccacagaagccggtacccccacttgacacagacagatttgtgctactggtatcc
ggactgggcctgggcggtggtggcggggagagcctcctgggcacccagctgctggtggac
gtggtgacgggacagcttggggacgaaggagaacagtgcagtgctgcccacgtctctcga
gtcatcctcgcaggcaacctgctcagccataacacccagagcagagactccatcaacaag
gccaaataccttaccaagaaaacccaggcagccagtgtggaggcagtcaaaatgctggac
gagatccttctgcaactgagtgcctcggtaccggtggatgtgatgccaggcgagtttgat
cccaccaactatacactcccgcagcagcccctgcacccctgcatgttcccgctggccacc
gcctactccacactccagctggtcaccaacccataccaagccaccattgatggagtaagg
ttcctggggacatctggacagaacgtgagtgatatcttccggtatagcagcatggaagac
cacttagagatcctagagtggaccctgcgggttcgtcacatcagccccacggctccagac
accctagggtgctaccccttctacaaaaccgacccgttcatctttccggaatgtcctcac
gtctacttctgtggcaacacccccagctttggttccaaaatcatccgaggtcctgaggac
caggtagtgctgttagtggctgttcctgacttcagttccacacagacggcctgcctagtg
aacttacgcagcctggcctgccagcctatcagctttgcgggcttcggggcagagcaagag
gacctggagggcctggggctgggtccctag

KEGG   Mus musculus (mouse): 67967
Entry
67967             CDS       T01002                                 

Gene name
Pold3, 2410142G14Rik, C85233, P6, P66, P68
Definition
(RefSeq) polymerase (DNA-directed), delta 3, accessory subunit
  KO
K03504  DNA polymerase delta subunit 3
Organism
mmu  Mus musculus (mouse)
Pathway
mmu03030  DNA replication
mmu03410  Base excision repair
mmu03420  Nucleotide excision repair
mmu03430  Mismatch repair
mmu03440  Homologous recombination
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03030 DNA replication
    67967 (Pold3)
   03410 Base excision repair
    67967 (Pold3)
   03420 Nucleotide excision repair
    67967 (Pold3)
   03430 Mismatch repair
    67967 (Pold3)
   03440 Homologous recombination
    67967 (Pold3)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:mmu01009]
    67967 (Pold3)
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:mmu03032]
    67967 (Pold3)
   03400 DNA repair and recombination proteins [BR:mmu03400]
    67967 (Pold3)
Protein phosphatases and associated proteins [BR:mmu01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     67967 (Pold3)
DNA replication proteins [BR:mmu03032]
 Eukaryotic type
  DNA Replication Elongation Factors
   DNA polymerase delta complex
    67967 (Pold3)
DNA repair and recombination proteins [BR:mmu03400]
 Eukaryotic type
  SSBR (single strand breaks repair)
   BER (base exicision repair)
    Long Patch-BER factors
     DNA polymerase delta complex
      67967 (Pold3)
   MMR (mismatch excision repair)
    DNA polymerase delta complex
     67967 (Pold3)
SSDB
Motif
Pfam: CDC27
Other DBs
NCBI-GeneID: 67967
NCBI-ProteinID: NP_001355309
MGI: 1915217
Ensembl: ENSMUSG00000030726
Vega: OTTMUSG00000025292
Position
7; 7 E2
AA seq 462 aa
MAEQLYLENIDEFVTDQNKIVTYKWLSYTLGVHVNQAKQMLYEYVERKRKENSGAQLHVT
YLVSGSLIQNGHSCHKVAVVREDKLEAVKSKLAVTASIHVYSIQKAMLKDSGPLFNTDYD
ILKSNLQNCSKFSAIQCAAAVPRAPAESPSSRKYEQSNLQAASEAQASELTTNGHGPPAS
KQASQQPKGIMGMLISKAATKTQDTNKETKPEAREVTSASSAGGKAPGKGSVMSNFFGKA
AMNKLKVNLDSEQAVKEEKTVEQPPVSVTEPKLAAPPAQKKSSRKSEPGKVQQKEKSSRG
KRVDLSDEEAKETEHLKKKRRRIKLPQSDSSEDEVFEDSPEMYEADSPSPPPVSPPPDPM
PKTEPPPVKRSSGETKRRRKRVLKSKTFVDEEGCIVTEKVYESESCTDSEEELKMKPASA
HKPPAAAVKREPREERKGPKKGAAALGKANRQVSITGFFQKK
NT seq 1389 nt   +upstreamnt  +downstreamnt
atggcggaacagctgtatctagaaaacatagacgagttcgtcacggaccagaacaagatc
gtgacttacaagtggctaagctatacactaggggttcatgttaaccaggccaaacagatg
ctctatgaatatgttgaaaggaaacggaaagaaaattcgggagctcagctgcatgttacc
tacttggtgtctggcagtcttatacagaacggacattcttgccacaaggttgcagtagtg
agagaagataaactggaagcagtgaagtccaagttagctgtgactgccagcatccatgtg
tacagcatccagaaagctatgctaaaggacagtgggcctctgttcaataccgactatgac
atccttaaaagcaatttgcagaactgcagcaagtttagtgccatacagtgtgcagctgca
gtccccagagctcctgcagaatccccatcttccagaaagtatgaacagtcaaatcttcag
gcagcgagtgaggcacaagccagtgagctgactaccaatggccatggtccacctgcctcc
aaacaggcttcccagcagcccaaaggaattatgggaatgttaatctctaaagctgctact
aaaacccaggacaccaacaaggaaaccaaaccagaggcccgagaagtaaccagtgcatct
tctgctgggggcaaagcaccaggaaaagggagtgtgatgagcaacttttttggaaaagct
gcaatgaataaacttaaagtcaatttggattcagaacaagcagtaaaggaagaaaaaaca
gtggagcaacctccagtgtctgtcactgaaccaaagctggcagctcccccagctcagaag
aaatccagcagaaagtccgagcctgggaaggtgcagcagaaggagaaaagcagcaggggc
aagcgagtagacttgtcggatgaggaggcaaaggaaaccgaacacctgaagaaaaagaga
agaagaatcaagcttcctcagtctgatagcagtgaagatgaagtcttcgaagactcccct
gagatgtatgaagcagactcaccatctccacctcctgtatctccacctcctgatcctatg
ccaaaaactgagccccctcctgtcaagcgttcaagtggagaaaccaaaaggagacgaaag
cgtgtactgaaatctaaaacctttgtggatgaagaaggctgcatagtgactgagaaagtc
tatgagagtgagtcctgcacagacagtgaggaggagcttaagatgaagccggcctcagca
cacaaaccccctgctgccgctgtgaaaagggagcccagagaagaacggaagggccccaag
aaaggggctgctgctctgggcaaagccaacagacaagtgtccattactggcttcttccag
aaaaagtaa

KEGG   Mus musculus (mouse): 69745
Entry
69745             CDS       T01002                                 

Gene name
Pold4, 2410012M21Rik, AI463381, AW060307, Polds, p1, p12
Definition
(RefSeq) polymerase (DNA-directed), delta 4
  KO
K03505  DNA polymerase delta subunit 4
Organism
mmu  Mus musculus (mouse)
Pathway
mmu03030  DNA replication
mmu03410  Base excision repair
mmu03420  Nucleotide excision repair
mmu03430  Mismatch repair
mmu03440  Homologous recombination
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03030 DNA replication
    69745 (Pold4)
   03410 Base excision repair
    69745 (Pold4)
   03420 Nucleotide excision repair
    69745 (Pold4)
   03430 Mismatch repair
    69745 (Pold4)
   03440 Homologous recombination
    69745 (Pold4)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:mmu03032]
    69745 (Pold4)
   03400 DNA repair and recombination proteins [BR:mmu03400]
    69745 (Pold4)
DNA replication proteins [BR:mmu03032]
 Eukaryotic type
  DNA Replication Elongation Factors
   DNA polymerase delta complex
    69745 (Pold4)
DNA repair and recombination proteins [BR:mmu03400]
 Eukaryotic type
  SSBR (single strand breaks repair)
   BER (base exicision repair)
    Long Patch-BER factors
     DNA polymerase delta complex
      69745 (Pold4)
   MMR (mismatch excision repair)
    DNA polymerase delta complex
     69745 (Pold4)
SSDB
Motif
Pfam: DNA_pol_delta_4
Other DBs
NCBI-GeneID: 69745
NCBI-ProteinID: NP_081472
MGI: 1916995
Ensembl: ENSMUSG00000024854
UniProt: Q9CWP8 Q547B4
Position
19; 19 A
AA seq 107 aa
MGRKRFITDSYPVVKKREGPPGHSKGELAPELGEDTQSLSQEETELELLRQFDLAWQYGP
CTGITRLQRWSRAEQMGLKPPLEVYQVLKAHPEDPHFQCSLWHLYPL
NT seq 324 nt   +upstreamnt  +downstreamnt
atgggtcggaagcggttcatcactgactcctatcctgttgtgaagaagagggaggggccc
cctgggcacagcaagggagagctggcacccgagctaggggaagacacccagtccctcagc
caggaggaaacagagctggagctgctgaggcagtttgacctggcctggcagtatgggcct
tgtacaggtatcacaaggctgcagcgctggagtcgggcagagcagatgggcttgaagccc
cccctagaggtgtaccaagtgttgaaggcacaccctgaagaccctcacttccaatgcagc
ctgtggcatctctacccactctga

DBGET integrated database retrieval system