KEGG   Mus musculus (mouse): 18972Help
Entry
18972             CDS       T01002                                 

Gene name
Pold2, 50kDa, p50, po1D2
Definition
(RefSeq) polymerase (DNA directed), delta 2, regulatory subunit
  KO
K02328  DNA polymerase delta subunit 2
Organism
mmu  Mus musculus (mouse)
Pathway
mmu03030  DNA replication
mmu03410  Base excision repair
mmu03420  Nucleotide excision repair
mmu03430  Mismatch repair
mmu03440  Homologous recombination
Module
mmu_M00262  DNA polymerase delta complex
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03030 DNA replication
    18972 (Pold2)
   03410 Base excision repair
    18972 (Pold2)
   03420 Nucleotide excision repair
    18972 (Pold2)
   03430 Mismatch repair
    18972 (Pold2)
   03440 Homologous recombination
    18972 (Pold2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:mmu03032]
    18972 (Pold2)
   03400 DNA repair and recombination proteins [BR:mmu03400]
    18972 (Pold2)
DNA replication proteins [BR:mmu03032]
 Eukaryotic Type
  DNA Replication Elongation Factors
   DNA polymerase delta complex
    18972 (Pold2)
DNA repair and recombination proteins [BR:mmu03400]
 Eukaryotic Type
  SSBR (single strand breaks repair)
   BER (base exicision repair)
    Long Patch-BER factors
     DNA polymerase delta complex
      18972 (Pold2)
   MMR (mismatch excision repair)
    DNA polymerase delta complex
     18972 (Pold2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DNA_pol_E_B DNA_pol_D_N
Motif
Other DBs
NCBI-GeneID: 18972
NCBI-ProteinID: NP_032920
MGI: 1097163
Ensembl: ENSMUSG00000020471
Vega: OTTMUSG00000005094
UniProt: O35654
Position
11; 11 A1
AA seq 469 aa AA seqDB search
MFSEQAAQRAHTLLAPPSASNATFARVPVATYTNSSQPFRLGERSFNRQYAHIYATRLIQ
MRPFLVSRAQQHWGSRVEVKKLCELQPGEQCCVVGTLFKAMSLQPSILREISEEHNLVPQ
PPRSKYIHPDDELVLEDELQRIKLKGTIDVSKLVTGTVLAVLGSAKDDGRFQVEDHCFAD
LAPQKPVPPLDTDRFVLLVSGLGLGGGGGESLLGTQLLVDVVTGQLGDEGEQCSAAHVSR
VILAGNLLSHNTQSRDSINKAKYLTKKTQAASVEAVKMLDEILLQLSASVPVDVMPGEFD
PTNYTLPQQPLHPCMFPLATAYSTLQLVTNPYQATIDGVRFLGTSGQNVSDIFRYSSMED
HLEILEWTLRVRHISPTAPDTLGCYPFYKTDPFIFPECPHVYFCGNTPSFGSKIIRGPED
QVVLLVAVPDFSSTQTACLVNLRSLACQPISFAGFGAEQEDLEGLGLGP
NT seq 1410 nt NT seq  +upstreamnt  +downstreamnt
atgttctccgagcaggcagcacagagggcccacactctgctcgccccgccctctgccagc
aatgccacctttgcccgggtacctgtggcaacttacaccaactcctcacagcccttccga
ctgggagagcgcagctttaaccggcagtacgcccatatttatgccacccgcctcatccag
atgagaccgttcctggtgagccgggcgcagcaacactggggcagccgagttgaagtgaag
aagttgtgtgagctgcagcctggggagcagtgctgtgtggtgggcacgctgttcaaagcc
atgtccctccaaccctccatcctgcgggagatcagcgaggagcacaacctggtcccccag
cctccacggagcaaatatatccacccggatgacgagctggtcttagaagatgagctgcag
cgtatcaaactgaaaggcaccattgatgtgtcaaagctggtcacaggaacggtcttggcc
gtgttgggctctgcgaaagatgacgggaggtttcaggttgaagaccactgctttgctgac
ctggctccacagaagccggtacccccacttgacacagacagatttgtgctactggtatcc
ggactgggcctgggcggtggtggcggggagagcctcctgggcacccagctgctggtggac
gtggtgacgggacagcttggggacgaaggagaacagtgcagtgctgcccacgtctctcga
gtcatcctcgcaggcaacctgctcagccataacacccagagcagagactccatcaacaag
gccaaataccttaccaagaaaacccaggcagccagtgtggaggcagtcaaaatgctggac
gagatccttctgcaactgagtgcctcggtaccggtggatgtgatgccaggcgagtttgat
cccaccaactatacactcccgcagcagcccctgcacccctgcatgttcccgctggccacc
gcctactccacactccagctggtcaccaacccataccaagccaccattgatggagtaagg
ttcctggggacatctggacagaacgtgagtgatatcttccggtatagcagcatggaagac
cacttagagatcctagagtggaccctgcgggttcgtcacatcagccccacggctccagac
accctagggtgctaccccttctacaaaaccgacccgttcatctttccggaatgtcctcac
gtctacttctgtggcaacacccccagctttggttccaaaatcatccgaggtcctgaggac
caggtagtgctgttagtggctgttcctgacttcagttccacacagacggcctgcctagtg
aacttacgcagcctggcctgccagcctatcagctttgcgggcttcggggcagagcaagag
gacctggagggcctggggctgggtccctag

DBGET integrated database retrieval system