KEGG   Mus musculus (mouse): 18973Help
Entry
18973             CDS       T01002                                 

Gene name
Pole
Definition
(RefSeq) polymerase (DNA directed), epsilon
  KO
K02324  DNA polymerase epsilon subunit 1 [EC:2.7.7.7]
Organism
mmu  Mus musculus (mouse)
Pathway
mmu03030  DNA replication
mmu03410  Base excision repair
mmu03420  Nucleotide excision repair
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03030 DNA replication
    18973 (Pole)
   03410 Base excision repair
    18973 (Pole)
   03420 Nucleotide excision repair
    18973 (Pole)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:mmu03032]
    18973 (Pole)
   03400 DNA repair and recombination proteins [BR:mmu03400]
    18973 (Pole)
Enzymes [BR:mmu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.7  DNA-directed DNA polymerase
     18973 (Pole)
DNA replication proteins [BR:mmu03032]
 Eukaryotic type
  DNA Replication Elongation Factors
   DNA polymerase epsilon complex
    18973 (Pole)
DNA repair and recombination proteins [BR:mmu03400]
 Eukaryotic type
  SSBR (single strand breaks repair)
   BER (base exicision repair)
    Long Patch-BER factors
     DNA polymerase epsilon complex
      18973 (Pole)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DUF1744 DNA_pol_B_exo1 DNA_pol_B DNA_pol_B_exo2 RNase_H_2 APP_N
Motif
Other DBs
NCBI-GeneID: 18973
NCBI-ProteinID: NP_035262
MGI: 1196391
Ensembl: ENSMUSG00000007080
Vega: OTTMUSG00000026219
UniProt: Q9WVF7 Q80XH7 Q3UR94
Position
5 F; 5 53.45 cM
AA seq 2283 aa AA seqDB search
MVLRNSGRRHPEPGADGEGSRDDGPSSSVSALKRLERSQWTDKMDLRFGFERLKEPGERT
GWLINMHPTEILDEDKRLVSAVDYYFIQDDGSRFKVALPYMPYFYIAARKGCDREVSSFL
SKKFQGKIAKLENVPKEDLDLPNHLVGLKRSYIKLSFHTVEDLVKVRKEISPAVKKNREQ
DHASDEYTTMLSSILQGGSVITDEDETSKKIADQLDNIVDMREYDVPYHIRLSIDLRIHV
AHWYNVRFRGNAFPVEITRRDDLVERPDPVVLAFDIETTKLPLKFPDAETDQIMMISYMI
DGQGYLITNREIVSEDIEDFEFTPKPEYEGPFCVFNEPDEVHLIQRWFEHIQETKPTIMV
TYNGDFFDWPFVEARAAIHGLSMYQEIGFQKDSQGEYKAPQCIHMDCLRWVKRDSYLPVG
SHNLKAAAKAKLGYDPVELDPEDMCRMATEQPQTLATYSVSDAVATYYLYMKYVHPFIFA
LCTIIPMEPDEVLRKGSGTLCEALLMVQAFHANIIFPNKQEQEFNKLTDDGHMLDAETYV
GGHVEALESGVFRSDIPCRFRMNPAAFDFLLQRVEKTMRHAIEEEEKVPVEQATNFQEVC
EQIKTKLTSLKDVPNRIECPLIYHLDVGAMYPNIILTNRLQPSAIVDEATCAACDFNKPG
ASCQRKMAWQWRGEFMPASRSEYHRIQHQLESEKFPPLFPEGPARAFHELSREEQAKYEK
RRLADYCRKAYKKIHVTKVEERLTTICQRENSFYVDTVRAFRDRRYEFKGLHKVWKKKLS
AAVEVGDASEVKRCKNMEILYDSLQLAHKCILNSFYGYVMRKGARWYSMEMAGIVCFTGA
NIITQARELIEQIGRPLELDTDGIWCVLPNSFPENFVIKTTNAKKPKLTISYPGAMLNIM
VKEGFTNHQYQELTEPSSLTYVTHSENSIFFEVDGPYLAMILPASKEEGKKLKKRYAVFN
EDGSLAELKGFEVKRRGELQLIKIFQSSVFEAFLKGSTLEEVYGSVAKVADYWLDVLYSK
AANMPDSELFELISENRSMSRKLEDYGEQKSTSISTAKRLAEFLGDQMVKDAGLSCRYII
SRKPEGSPVTERAIPLAIFQAEPTVRKHFLRKWLKSSSLQDFDIRTILDWDYYIERLGSA
IQKIITIPAALQQVKNPVPRVKHPDWLHKKLLEKNDIYKQKKISELFVLEGKRQIVMAQA
SENSLSLCTPDMEDIGLTKPHHSTVPVATKRKRVWETQKESQDIALTVPWQEVLGQPPSL
GTTQEEWLVWLQFHKKKWQLQAQQRLALRKKQRLESAEDMPRLGPIREGPSTGLGSFLRR
TARSIMDLPWQIIQISETRQAGLFRLWAIIGNDLHCIKLSIPRVFYVNQRVAKAEDGPAY
RKVNRALPRSNIVYNLYEYSVPEDMYQEHINEINTELSVPDIEGVYETQVPLLFRALVQL
GCVCVVNKQLTRHLSGWEAETFALEHLEMRSLAQFSYLEPGSIRHIYLYHHTQGHKALFG
VFIPSQRRASVFVLDTVRSNQMPGLSALYSSEHSLLLDKVDPKLLPPPKHTFEVRAETNL
KTICRAIQRFLLAYKEERRGPTLIAVQSSWELCRLTSEIPVLEEFPLVPIRVADKISYAV
LDWQRHGARRMIRHYLNLDLCLSQAFEMSRYFHIPVGNLPEDISTFGSDLFFARHLQHHN
HLLWLSPTSRPDLGGKEADDNRLVMEFDDRATVEINSSGCYSTVCVELDIQNLAVNTILQ
SHHVNDMEGAGSMGISFDVIQQASLEDMVTGNQAASALANYDETALCSSTFRILKSMVVG
WVKEITQYHNIYADNQVMHFYRWLQSPCSLLHDPALHRTLHNMMKKLFLQLIAEFKRLGS
SVVYANFNRIILCTKKRRIEDALAYVEYITNSIHSKEIFHSLTISFSRCWEFLLWMDPSN
YGGIKGKVPSSIHCGQVKEQDSQAREETDEEEEDKEKDEEEEGMGESEVEDLLENNWNIL
QFLPQAASCQSYFLMIVSAYIVAVYQSMKEELRHSAPGSTPVKRKGASQFSQESEGATGS
LPGMITFSQDYVANELTQSFFTITQKIQKKVTGSRNTTEPSEMFPVLPGSHLLLNNPALE
FIKYVCKVLSLDTNITNQVNKLNRDLLRLVDVGEFSEEAQFRDPCHSYVLPEVICHSCNF
CRDLDLCKDSSFSQDGAILPQWLCSNCQAPYDSSAIESALVEALQRKLMAFTLQDLVCLK
CRGMKETHMPVYCSCAGDFTLTIRTEVFMEQIRIFQNIAKYYSMSYLQETIEWLLQTSPV
SNC
NT seq 6852 nt NT seq  +upstreamnt  +downstreamnt
atggtcctgaggaacagtggacggaggcaccccgagccgggcgcggatggcgaaggcagc
cgggatgatggtccctcttcctcagtctcagcactcaagcgtctggaacggagccagtgg
acagacaagatggacttacggtttggtttcgaaaggctgaaagagcctggagaaaggact
ggctggctgatcaacatgcaccctactgagatcttagatgaagacaaacgcttagtcagc
gcggtggattactacttcattcaagatgatggaagcagatttaaggtggccttgccctat
atgccgtatttctacattgcagcgagaaagggttgtgatcgagaagtttcatcttttcta
tccaagaagtttcagggaaaaattgcaaagttagagaatgtgcccaaagaagatctggac
ttgccaaatcacttggtgggcttgaagcggagttacatcaagctgtccttccacactgtg
gaggaccttgtcaaagtgagaaaggagatctctcctgctgtgaagaagaaccgagagcag
gaccatgctagtgatgagtatacaacaatgctctccagtattctgcaaggtggcagtgta
attactgatgaggacgaaacctctaagaagatagctgaccaattggacaacatagtggac
atgcgagagtatgatgttccctaccacattcgcctctccattgacctcagaatccatgtg
gcccactggtacaatgttagatttcgaggaaatgcttttcctgtggaaatcacccgacga
gatgatcttgttgaacgacctgaccctgtggttttggcatttgacatcgagacgaccaaa
ctgcctctcaaattccctgatgctgagaccgatcagatcatgatgatctcctatatgatt
gatggccagggctacctcatcactaacagggagattgtttcagaagatattgaagatttt
gagttcacccctaagccagaatatgaagggcccttttgtgtcttcaatgaacccgacgag
gtccatctgatccagagatggtttgagcatatccaggaaaccaaacctaccattatggtc
acctacaatggggatttttttgactggccatttgtggaggctagggcagcaattcatggc
ctcagcatgtaccaggagataggcttccagaaggatagccagggggaatataaggcacca
cagtgcatccacatggactgcctcaggtgggtgaagagggacagttaccttcctgtgggc
agtcataatctcaaggcagctgccaaggccaaacttggctatgaccctgtagagctggac
cctgaggacatgtgtcgtatggccactgaacagccccagactctggccacttactcagtg
tcagatgctgtggctacttactacctgtacatgaaatacgtccaccccttcatattcgcc
ctgtgcaccattattcccatggaacctgatgaggtgctgcggaagggctccgggacactg
tgtgaagccttgctgatggtgcaagctttccatgccaacattatcttccccaataagcaa
gagcaggagttcaacaagctgacagatgatggccacatgctagatgctgagacctacgtc
gggggccacgtggaggcactagagtctggtgtcttcagaagtgatatcccctgccggttt
aggatgaatcctgcagcctttgatttcctgctgcaacgagtcgagaagactatgcgccac
gccattgaagaagaagagaaggtgcctgtggaacaagccaccaactttcaagaggtgtgt
gagcagattaagaccaagctcacctccctaaaagatgttcctaacagaattgaatgtcct
ctaatctaccatctagatgtgggggccatgtatcctaacataattcttaccaaccgccta
cagccttctgccatagtggatgaggccacctgtgctgcctgtgacttcaataagcctgga
gcaagttgtcagaggaagatggcctggcagtggaggggagaattcatgccagccagtcgc
agtgaataccatcggattcagcatcagctggagtcggagaagtttccccctttgtttcca
gaggggccagcacgggcctttcacgagctgtcccgtgaagaacaggctaaatacgagaag
aggaggctggcagattattgccggaaagcctataagaagatccatgtgaccaaggtagaa
gaacgtctaactaccatctgccagcgggaaaactcattttatgtggacacagtgcgggcc
ttcagagacaggcgctatgagttcaaaggactgcacaaggtgtggaagaagaagctctcg
gcagctgtagaggtgggcgatgcatcagaggtgaagcgctgcaagaacatggagatcctt
tacgattcactgcagctggctcacaagtgcatcctgaactccttctacggctatgtcatg
cgcaaaggagctcgctggtattccatggagatggctggtatcgtctgctttacaggagcc
aacatcatcacccaagcaagagaactgattgagcagatcgggaggcctttagaattggac
acggacggaatatggtgcgtcctacccaatagctttcctgaaaattttgtcatcaagaca
accaatgcgaagaaacccaaactgaccatctcctatcctggtgccatgttgaacatcatg
gtcaaggaaggctttaccaaccaccagtaccaggaactaacagagccttcgtctctcacc
tatgtcacccactctgagaatagtatcttttttgaagtcgatggaccataccttgctatg
atccttccagcctccaaggaagaaggcaagaagctgaagaaaagatatgctgtgttcaat
gaagatggttccttggctgaactgaaaggttttgaggtgaaacgccgaggggagttgcag
ctgattaaaatattccagtcctcagtttttgaggccttcctcaagggcagcacactggag
gaagtgtatggctcggtggccaaagtggctgactactggctagatgtgctctatagcaag
gctgctaatatgcccgattctgaattgtttgagctgatttctgagaaccgctccatgtct
cggaagctggaagattacggggagcagaagtctacatccatcagcacagcaaagcgcctg
gctgagttcctgggagaccagatggtcaaagatgctggactgagctgccgctatatcatc
tcccgaaagccagaggggtctcctgtcactgagagggccattccacttgccattttccaa
gcagagcctacagtgaggaaacattttctccggaaatggctaaagagttcatcacttcaa
gactttgatattcggacaattctggactgggactactacatagagaggctggggagtgcc
atccagaaaatcatcaccatccccgcagctctgcagcaggtgaagaacccagttccacgt
gtcaaacatccagactggctacacaaaaaactactagagaagaatgatatctacaaacag
aagaagatcagtgagctctttgtgcttgaaggaaagagacagattgtgatggcccaggct
tcagaaaacagtctgagtctctgcactccagacatggaggacattggactcacaaagcca
caccactctacagtcccagttgctactaagaggaagcgagtctgggagacccaaaaggag
tctcaggatattgcactaactgtgccctggcaagaggtcttagggcagcctccctccctt
ggaaccacacaggaagagtggttggtctggctccagttccacaagaaaaagtggcagctg
caggcccaacagcgcctagccctcaggaagaagcaacgcttagagtcagcagaagatatg
ccaaggcttgggcctatccgagaggggccttccacaggactggggagctttttgcgaagg
actgcccgcagcatcatggaccttccatggcagataatacagatcagtgagaccagacag
gctggtctgttccggctgtgggctatcattggcaatgacttgcactgcatcaagctgagt
atccctcgagtattctatgtaaaccagcgggttgccaaagcagaggatggacctgcatat
cggaaggtgaatcgggctcttcctcgttccaacattgtctacaatctctatgagtattca
gtaccagaggacatgtaccaagaacacatcaacgagatcaacactgagttgtcagtacca
gacattgagggcgtgtatgagacacaggtcccattgttattccgggccctcgtgcagctg
ggctgtgtgtgtgtggtcaacaagcagctgacaaggcacctttcgggctgggaagctgaa
acttttgccctcgagcaccttgaaatgcgttctctggcccagttcagctacttggaacca
gggagtatccgccatatctacctgtaccatcacactcagggccacaaggcactctttggg
gtctttatcccctcacagcgaagagcatctgtgtttgtgttggatactgtacgaagcaac
caaatgccagggctcagtgccctgtactcatcagaacacagcctgctgctggacaaggtg
gaccccaagctcctgcctcccccaaaacacacctttgaagttcgtgctgaaaccaacctg
aagactatctgcagagccatccagcgcttcctgcttgcctacaaggaagagcgccgaggg
cccacactcatcgctgtccagtctagctgggagctgtgtaggctgaccagtgagattcca
gtcttagaagagttcccactagtgcctatccgagtggctgacaagatcagctatgcagtc
ctggactggcagcgccatggagctcgccgaatgatccggcactacctcaatttagacttg
tgcctgtcgcaggcctttgagatgagcaggtacttccacatccctgttggaaacctgccg
gaagacatctccacctttggctcagacctcttttttgcacgccacctccagcaccataac
cacctgctttggctatcccctacctctcggcctgacctgggtgggaaggaagctgatgac
aaccgccttgtcatggagtttgatgaccgagccactgtggagatcaatagttctggctgt
tactctactgtgtgcgtggaactggacattcaaaatctggcagtcaacaccatcctccag
tcccatcatgtcaatgacatggagggggctggcagcatgggcatcagcttcgatgtgatc
cagcaggcctccctagaggacatggtaacaggcaatcaagctgccagtgccctggccaac
tacgatgagacagccctctgctctagtaccttcaggatcctgaagagcatggtggttggc
tgggtaaaggaaatcacacagtaccacaacatctatgctgacaaccaggtaatgcacttc
taccgctggctccagtcaccgtgctctctgctccacgacccagcccttcaccggacgctg
cacaacatgatgaagaagctcttcctgcagctcattgctgagttcaagcgcctggggtca
tcagtcgtctatgccaacttcaatcgcatcattctctgtacaaagaagcgccgaatagag
gatgcccttgcctatgtggaatatattaccaacagcatccattctaaagagatcttccat
tccctgaccatctctttctctcgatgctgggaattccttctctggatggatccatccaac
tatggtggaatcaaaggaaaagttccatctagtattcactgtggacaggtaaaagagcaa
gactcccaggcaagagaggaaactgatgaagaggaggaggacaaggaaaaggacgaggag
gaagagggcatgggagagtccgaggttgaggacttactggagaacaactggaacattcta
cagttcttgccccaggcagcctcttgccagagctacttcctcatgattgtttcagcatac
atcgtagctgtgtaccaaagcatgaaggaggagttgagacacagtgccccgggcagtacc
cctgtgaagaggaagggggccagccagttctcccaggagtctgaaggggcaactggatct
cttcctggaatgatcactttctctcaagattatgtggcaaatgagctcactcagagcttc
ttcaccattactcagaaaattcagaagaaagtcacaggttctcggaacaccactgagccc
tcagagatgttccccgtcctccctggttcacacttgctgctcaataatcctgctctggag
ttcatcaaatatgtgtgcaaggtactatctctggatacaaacatcacaaatcaggtgaat
aagctgaacagagaccttcttcgcctggtagacgttggtgaattctctgaggaggcccag
ttcagagacccctgccactcctacgtgctccctgaggtaatctgccacagctgtaatttc
tgccgagacctggacctgtgcaaagattcctctttctctcaggatggagccatcctgcct
cagtggctctgctccaattgtcaagccccctatgactcctctgccattgagtcagccttg
gtggaagccctgcagaggaaactgatggccttcacacttcaggacctggtatgcctcaag
tgccgtggtatgaaagagacccatatgcctgtgtactgcagctgcgcaggggactttact
ctcaccatccgcactgaggtcttcatggaacagattagaatcttccagaacattgccaag
tactacagcatgtcatatctccaggagaccatagaatggctgttacagacaagccctgta
tcaaactgttag

DBGET integrated database retrieval system