KEGG   Mus musculus (mouse): 18974
Entry
18974             CDS       T01002                                 

Gene name
Pole2
Definition
(RefSeq) polymerase (DNA directed), epsilon 2 (p59 subunit)
  KO
K02325  DNA polymerase epsilon subunit 2 [EC:2.7.7.7]
Organism
mmu  Mus musculus (mouse)
Pathway
mmu03030  DNA replication
mmu03410  Base excision repair
mmu03420  Nucleotide excision repair
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03030 DNA replication
    18974 (Pole2)
   03410 Base excision repair
    18974 (Pole2)
   03420 Nucleotide excision repair
    18974 (Pole2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:mmu03032]
    18974 (Pole2)
   03400 DNA repair and recombination proteins [BR:mmu03400]
    18974 (Pole2)
Enzymes [BR:mmu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.7  DNA-directed DNA polymerase
     18974 (Pole2)
DNA replication proteins [BR:mmu03032]
 Eukaryotic type
  DNA Replication Elongation Factors
   DNA polymerase epsilon complex
    18974 (Pole2)
DNA repair and recombination proteins [BR:mmu03400]
 Eukaryotic type
  SSBR (single strand breaks repair)
   BER (base exicision repair)
    Long Patch-BER factors
     DNA polymerase epsilon complex
      18974 (Pole2)
SSDB
Motif
Pfam: DNA_pol_E_B Dpoe2NT
Other DBs
NCBI-GeneID: 18974
NCBI-ProteinID: NP_035263
MGI: 1197514
Ensembl: ENSMUSG00000020974
UniProt: O54956
Position
12; 12 C2
AA seq 527 aa
MAPERLRSRTVSAFKLRGLLLRSEATKYLTEALQSVTELELEENLGKIIDAVEKQPLSSN
MIERSVVEAAVQECSQSMDETIEHVFNIIGAFDIPRFIYNSERKKFLPLSMTNHAAPTLF
GTARDKAELYLERYTILHQRTHRHELFTPPVIGSHLEESGSKFQLKTIETLLGSTSKVGD
VIVLGMITQLKEGKFFLEDPTGTVQLDLSKAQFHSGLYTEACFVLAEGWFEDQVFHANAF
GFPPTEPSSTTRAYYGNINFFGGPSNASVKTYTKLRQLEDENKDAMFVIVSDVWLDQVQV
LEKFHVMFSGYSPAPPTCFILCGNFSSAPYGKNQVQALKDSLKSLADIICEYPSIHQSSR
FVFVPGPEDPGFGSILPRPPLAESITQEFRQRVPFSVFTTNPCRIQYCTQEIIIFREDLV
NKMCRNCVRFPSSSLDIPTHFVKTILSQGHLAPLPLYVCPVHWAYDYTLRVYPVPDLLVI
ADKYDPFTVTNTDCLCINPGSFPRSGFAFKVFYPSSKTVEDSKLQGF
NT seq 1584 nt   +upstreamnt  +downstreamnt
atggcgccggagcggctgcggagccgcacggtctcagctttcaagctgcggggcttgctg
ctcaggagtgaagccaccaagtatctgactgaagctctccagtctgtcactgaattggag
ctagaggagaacctaggaaagatcatcgatgcagttgaaaagcagcccttgtcctcgaac
atgatcgaacgatctgtcgtggaggcagctgtgcaagagtgcagtcagtctatggatgag
actatagagcacgttttcaatatcattggagcttttgatattccacgttttatatataat
tcagaaaggaaaaaatttcttcctctatccatgactaatcatgctgcaccaaccttattt
ggaacagcaagagacaaagccgagctgtatcttgaacgctataccattttacaccagagg
acacacagacatgaattgttcactcctccggtgataggctcacaccttgaagaaagtggg
agcaagttccagcttaaaactatagaaaccttactgggtagcacaagcaaagttggtgac
gtgatcgtcctggggatgataacccagctgaaagaggggaagtttttcctggaagatcct
actggaacagtacaactggaccttagtaaagctcagttccacagtggcttatacaccgag
gcctgcttcgtcctggcagaaggttggtttgaagatcaagtgtttcacgccaatgccttt
ggatttcctcccactgagccctccagcaccacaagggcgtactatggaaatattaatttt
tttggagggccttctaatgcatcagtgaagacgtatacaaagctgagacagctggaagat
gagaacaaggacgccatgtttgtgattgtgtctgatgtttggttggaccaagtgcaagtg
ttggagaagtttcatgtaatgttttctggttactcgccagcacctccaacctgctttatt
ctgtgtggtaatttttcatctgcaccatatggaaaaaatcaagtccaggctttgaaagat
tccctaaaatctttggcagacataatttgtgaatatccaagtatccaccaaagtagccgt
tttgtgtttgtgcctggcccagaggatcctggatttggttccattttaccaaggccgcca
ctcgctgaaagcatcacacaggaattcagacaaagggttccgttttcagttttcacgact
aatccttgcagaattcagtattgtacacaagaaataattatcttccgtgaagacttagtg
aataaaatgtgtagaaactgtgtccgttttcctagcagcagtttggatattcctactcac
ttcgtaaagaccatcttatctcagggacatctggctcctctccctctttacgtatgcccc
gtccactgggcatatgattacacgttgagagtgtacccggtgcccgacctgctggtcatt
gcagacaagtacgacccgttcaccgtgaccaacaccgattgcctctgcataaaccctggc
tcctttccaagaagtggatttgcattcaaagttttttacccttccagtaaaacagtagaa
gacagcaaacttcagggcttttga

DBGET integrated database retrieval system