KEGG   Mus musculus (mouse): 18991
Entry
18991             CDS       T01002                                 

Gene name
Pou3f1, Oct, Oct-, Oct-6, Oct6, Otf, Otf-6, Otf6, S, Scip, Test1, Tst, Tst-, Tst-1, Tst1
Definition
(RefSeq) POU domain, class 3, transcription factor 1
  KO
K09365  POU domain transcription factor, class 3
Organism
mmu  Mus musculus (mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:mmu03000]
    18991 (Pou3f1)
Transcription factors [BR:mmu03000]
 Eukaryotic type
  Helix-turn-helix
   POU domain factors
    18991 (Pou3f1)
SSDB
Motif
Pfam: Pou Homeodomain HTH_31 Homeobox_KN
Other DBs
NCBI-GeneID: 18991
NCBI-ProteinID: NP_035271
MGI: 101896
Ensembl: ENSMUSG00000090125
Vega: OTTMUSG00000042459
UniProt: P21952 Q3UTH6
Structure
PDB: 
2XSD

Position
4 D2.2; 4 57.86 cM
AA seq 449 aa
MATTAQYLPRGPGGGAGGTGPLMHPDAAAAAAAAAERLHAGAAYREVQKLMHHEWLGAGA
GHPVGLAHPQWLPTGGGGGGDWAGGPHLEHGKAGGGGTGRADDGGGGGGFHARLVHQGAA
HAGAAWAQGGTAHHLGPAMSPSPGAGGGHQPQPLGLYAQAAYPGGGGGGLAGMLAAGGGG
AGPGLHHALHEDGHEAQLEPSPPPHLGAHGHAHGHAHAGGLHAAAAHLHPGAGGGGSSVG
EHSDEDAPSSDDLEQFAKQFKQRRIKLGFTQADVGLALGTLYGNVFSQTTICRFEALQLS
FKNMCKLKPLLNKWLEETDSSSGSPTNLDKIAAQGRKRKKRTSIEVGVKGALESHFLKCP
KPSAHEITGLADSLQLEKEVVRVWFCNRRQKEKRMTPAAGAGHPPMDDVYAPGELGPGGG
SASPPSAPPPPPPAALHHHHHHTLPGSVQ
NT seq 1350 nt   +upstreamnt  +downstreamnt
atggccaccaccgcgcagtatctgccgcggggccccggcggcggagctgggggcacaggg
ccgctcatgcatcccgatgccgccgcggcggcggcagcggcggccgagcggctgcacgcg
ggggccgcgtaccgcgaagtgcagaagctgatgcaccacgagtggctgggcgcgggcgcg
ggccaccccgtgggcctagcgcaccctcaatggctacccacgggaggaggcggcggcggc
gactgggcgggcggcccgcacctggaacacggcaaggcaggcggtggcggtaccggccga
gctgacgacggcggcggtggcggcggtttccacgcccgcctggtgcaccaaggggcggcc
cacgcgggcgcggcatgggcacaaggcggcacagcgcaccacttgggccccgccatgtcg
ccgtcgcccggggccggcgggggtcaccagccccagccgctcgggctgtacgctcaggcg
gcctaccccggtggcggcggcggcggcctggccgggatgctggcggcgggaggcggcggc
gcgggacccggcctgcaccacgcactgcacgaggacggccacgaggcacagctggagccg
tcgccaccaccgcacctgggcgcacacggacacgcacacggacatgcacacgcgggcggc
ctgcacgcggcggcggcgcacctgcacccgggcgcgggcggtggtggctcgtcggtgggc
gagcactcggacgaggatgctcccagctccgacgacctggagcagttcgccaagcagttc
aagcaacgacgcatcaagctgggcttcacccaggccgacgtgggactggcgctgggcacc
ctctacggtaacgtgttctcgcagaccaccatctgccgtttcgaggccctgcagctgagc
ttcaagaacatgtgcaagctcaagccgctgctcaacaagtggctggaggagaccgactcg
tccagcggcagccccaccaacctggacaagatcgcggcgcagggccgcaagcgcaagaag
cgcacgtccatcgaggtgggtgtcaaaggcgcgctcgagagccactttctcaagtgtccc
aagccgtctgcgcacgagatcaccggcctggccgacagcctgcaactggagaaggaggtg
gtgcgtgtctggttctgcaaccggcggcagaaggagaagcgcatgacccccgcggccggc
gcgggccacccgcccatggacgacgtttatgcgcctggggagctggggcctggcgggggc
agcgcgtcgccaccttctgcgcccccgccacccccgccggccgcgctgcaccaccaccac
caccacacactgcccggctctgtgcagtga

DBGET integrated database retrieval system